KEGG   Saccharomyces cerevisiae (budding yeast): YBR009CHelp
Entry
YBR009C           CDS       T00005                                 

Gene name
HHF1
Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YBR009C (HHF1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    YBR009C (HHF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S TFIID-31kDa Bromo_TP TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 852294
NCBI-ProteinID: NP_009563
SGD: S000000213
UniProt: P02309
Structure
PDB: 

Position
II:complement(255373..255684)
Genome map
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtagaggtaaaggtggtaaaggtctaggtaaaggtggtgccaagcgtcacaga
aagattctaagagataacatccaaggtattactaagccagctatcagaagattagctaga
agaggtggtgtcaagcgtatttctggtttgatctacgaagaagtcagagctgtcttgaaa
tccttcttggaatccgtcatcagagactctgttacctacaccgaacacgccaagagaaag
actgttacttctttggatgttgtttatgctttgaagagacaaggtagaaccttatacggt
ttcggtggttaa

DBGET integrated database retrieval system