KEGG   Saccharomyces cerevisiae (budding yeast): YBR021W
Entry
YBR021W           CDS       T00005                                 

Gene name
FUR4
Definition
(RefSeq) uracil permease
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    YBR021W (FUR4)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-GeneID: 852309
NCBI-ProteinID: NP_009577
SGD: S000000225
UniProt: P05316
Position
II:281443..283344
AA seq 633 aa
MPDNLSLHLSGSSKRLNSRQLMESSNETFAPNNVDLEKEYKSSQSNITTEVYEASSFEEK
VSSEKPQYSSFWKKIYYEYVVVDKSILGVSILDSFMYNQDLKPVEKERRVWSWYNYCYFW
LAECFNINTWQIAATGLQLGLNWWQCWITIWIGYGFVGAFVVLASRVGSAYHLSFPISSR
ASFGIFFSLWPVINRVVMAIVWYSVQAYIAATPVSLMLKSIFGKDLQDKIPDHFGSPNAT
TYEFMCFFIFWAASLPFLLVPPHKIRHLFTVKAVLVPFASFGFLIWAIRRAHGRIALGSL
TDVQPHGSAFSWAFLRSLMGCMANFSTMVINAPDFSRFSKNPNSALWSQLVCIPFLFSIT
CLIGILVTAAGYEIYGINYWSPLDVLEKFLQTTYNKGTRAGVFLISFVFAVAQLGTNISA
NSLSCGTDMSAIFPKFINIKRGSLFCAAMALCICPWNLMATSSKFTMALSAYAIFLSSIA
GVVCSDYFVVRRGYIKLTHIYSHQKGSFYMYGNRFGINWRALAAYLCGVAPCLPGFIAEV
GAPAIKVSDGAMKLYYLSYWVGYGLSFSSYTALCYFFPVPGCPVNNIIKDKGWFQRWANV
DDFEEEWKDTIERDDLVDDNISVYEHEHEKTFI
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgccagacaatctatcattacatttaagcggctcttcaaaaagattgaactctcgccaa
cttatggaatcttccaatgagacctttgcgccaaataatgtggatttggaaaaagagtat
aagtcatctcagagtaatataactaccgaagtttatgaggcatcgagctttgaagaaaaa
gtaagctcagaaaaacctcaatacagctcattctggaagaaaatctattatgaatatgtg
gtcgttgacaaatcaatcttgggtgtttctattctggattcatttatgtacaaccaggac
ttgaagcccgtcgaaaaagaaaggcgggtttggtcctggtacaattattgttacttctgg
cttgctgaatgtttcaatatcaacacttggcaaattgcagctacaggtctacaactgggt
ctaaattggtggcagtgttggataacaatttggattgggtacggtttcgttggtgctttt
gttgttttggcctctagagttggatctgcttatcatttgtcattccctatatcatctaga
gcatcattcggtattttcttctctttatggcccgttattaacagagtcgtcatggccatc
gtttggtatagtgtccaagcttatattgcggcaactcccgtatcattaatgctgaaatct
atctttggaaaagatttacaagacaaaatcccagatcactttggatcaccgaatgctact
acttacgagttcatgtgtttttttatcttttgggctgccagtcttccatttttactggtt
ccacctcacaaaattagacacctgtttactgttaaagccgtcttggttccgtttgcttct
tttggtttcttaatttgggctatcagaagagctcacgggcgtattgccttaggatcttta
accgatgtacaacctcatggctctgccttttcgtgggcttttctaagatcactaatgggt
tgtatggctaatttctccacaatggtaatcaacgctccagatttctctagattttcaaaa
aaccctaactccgctttatggtcccaattagtgtgcattccatttttgttttccatcact
tgtttaattggaattctagtcaccgcagctggttatgaaatatacggtattaattactgg
tcgccactcgatgtgctagaaaaatttttacagactacttataataagggcacaagagct
ggtgttttcttaatctcttttgttttcgccgtagctcagttaggtactaatatttctgca
aactcattatcgtgtggaactgatatgtccgctattttccccaagtttatcaatatcaag
cgtggttcattattttgtgcagccatggcgctgtgtatttgtccatggaatttaatggca
acatcaagtaaatttacaatggctttgtccgcatatgctatctttttgtccagtattgcc
ggtgttgtctgctcagattactttgttgttagaagaggatatatcaagctaacacacata
tattcccatcaaaagggctctttttatatgtacggaaacaggtttggtatcaattggaga
gctttggctgcatatctatgtggggtggctccttgcttgcccggtttcatcgcggaggtg
ggcgctcccgctataaaggtttctgatggagctatgaaactatattacctaagttactgg
gtaggatatggcttgagtttttcttcttatactgctctgtgttacttcttccctgtacct
gggtgccctgttaacaacattataaaggacaagggctggttccaaagatgggccaatgtc
gatgattttgaagaagagtggaaagacacaattgagagggatgacctggtagatgacaat
attagtgtctacgaacacgaacacgaaaagactttcatttaa

DBGET integrated database retrieval system