KEGG   Saccharomyces cerevisiae (budding yeast): YBR028CHelp
Entry
YBR028C           CDS       T00005                                 

Gene name
YPK3
Definition
(RefSeq) putative protein kinase YPK3
  KO
K22008  serine/threonine-protein kinase Psk1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YBR028C (YPK3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YBR028C (YPK3)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   YBR028C (YPK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like
Motif
Other DBs
NCBI-GeneID: 852316
NCBI-ProteinID: NP_009584
SGD: S000000232
UniProt: P38070
Position
II:complement(294425..296002)
Genome map
AA seq 525 aa AA seqDB search
MIFSLDEELHRVSLDDKKNDIKVDYSSAIYNDINHEQGSSITYEESINHLSVHSNAIPLN
GMSPAHRMRRRSSAYSKFPILTPPNTRRFSITGSDAMRTNTNRLSITPQDIISSNIGENE
LSRNLHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDK
NDGNNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELF
YHLKEHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSK
KSANDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKP
PYTGSNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDKYWAKTGANN
KPTKSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDT
EFTSMSYEETYTDSKPININSVSKSPDMFKGFSYKASGSYLEKYF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgattttctcactagatgaagaacttcatcgtgtgtcactagatgataaaaagaatgac
attaaagtagattattcctcggcaatatacaatgatatcaatcatgaacaaggcagctcc
atcacatatgaggagagtataaatcacctctcggttcattcaaatgcgattccgctaaat
ggcatgagtcctgcacataggatgagaagaaggtcctcagcttattccaaattccctatt
ctcactccaccaaatacgagaagattttctattacaggttcggacgcaatgcgaactaat
acgaatagactatccataacacctcaggacattatttcctctaatattggagaaaatgaa
ttatcaaggaacctgcacgattttaagcccgtgagagtcctaggccaaggtgcctacggt
aaagttcttcttgttaaggacgtcaatacatccaagctgtatgctatgaagcaattacgg
aaagcagaaattttaatttctcaaacagccacagattccaagagagaagacgaagataaa
aatgatggtaataacaacgataatgacgatggattatcaaagaggcttgagagaacattt
gccgaacggtctattctatctgaaatagaacatccaaacattgtcaagttattttattct
tttcacgataactcaaagttatatttactgctacaatatatccctggcggtgaactattt
taccacttgaaggaacacgggaccctagatgagacgacagtttcgttttacgcggcagaa
atcagctgtgccttgagatttttgcatacgaaaggtgttgtctatagagatttaaaacct
gaaaactgtttattgaatcaacgtggacatttagtattgacagattttggtctgagtaaa
aaaagtgctaatgattccgcggttgatgaggaggatccagagaacgtcaatgccctatac
tcgattatcggtacgcctgaatactgtgcgcctgaaatattattaggtaaagcttacagt
cagaattgtgattggtattctttgggatgtctgttgtatgacatgttagtaggtaagcct
ccatatactggtagcaatcataaggtgatcattaataagattcaacaaaacaagcaaggc
cccaaaattccattttatctgagcgagggaatgaaagatatattaaacgcgctgttgaag
aaggaaactgccaaaaggtggaatgttgacaaatactgggccaaaaccggggctaataat
aagcctactaagtctaagaagaagaaatcaggggctgcaagaactagtcttttcactgaa
cattttatctttagaaaaatagactggaagttattagaatctggacaattgcaaaaaacc
actctaggcccaattgttccagttattacggatttggaactagcggaaaattttgacaca
gaatttacttctatgtcatatgaggaaacctatacggatagcaagccgattaatatcaat
tcggtgagcaagtccccggatatgttcaagggatttagttataaagcaagtggtagctat
ttggagaagtacttttga

DBGET integrated database retrieval system