KEGG   Saccharomyces cerevisiae (budding yeast): YBR036C
Entry
YBR036C           CDS       T00005                                 
Symbol
CSG2, CLS2
Name
(RefSeq) mannosylinositol phosphorylceramide synthase regulatory subunit
  KO
K22722  inositol phosphorylceramide mannosyltransferase regulatory subunit
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    YBR036C (CSG2)
SSDB
Motif
Pfam: CSG2 DUF981
Other DBs
NCBI-GeneID: 852324
NCBI-ProteinID: NP_009592
SGD: S000000240
UniProt: P35206
Position
II:complement(309081..310313)
AA seq 410 aa
MSTTLLWFSSVIGYVIQTKCLSNIQSKKEISVGPNGTIATPETNGDNGNSSSLTFYLTFM
YFASWLLLVPASRLWEKMRPMFVSDSDSNRNSQFDNNNSGSVTNEDVDTFSHVLDDPQPR
IPAQQQKQKIISVATFKYVAKLTVLALIMIVADLTYNMALSLSPAFDVALMQNTAIFEIV
TLLYGVCGISRKNYVFRNFLIMMNAVIGILIISYTKATCDMLAGKLSVNPNTGELSDPFL
FDRLKGALICGLGALIMGPFAVLWNRWFCSNISKNENSAVVLVKQSTHMALIGIIGMVIL
LPFIPKFPSRESVESISLFYNDKSFWFSLLGSIIFGSLPSLISILELNRKAPAEYLTTCN
LGAIIFMGLAEWVCEPTQTTIVRWEVIGYIMLTVSLLVLSVTLGEGKYHH
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtctaccacactactttggttttcaagtgtaataggctacgtgattcaaacaaaatgt
ttgtctaacatacaatctaaaaaggaaatctccgtggggcccaatggtacaattgcaacg
cctgaaactaacggcgacaacggaaactcaagttcattaaccttctatctgacctttatg
tattttgcttcgtggctgctcttggtgcctgcatctcgactttgggagaagatgagaccg
atgtttgtctctgactcagactcgaacaggaattctcagtttgacaacaacaacagcggg
tctgtgacaaacgaagatgtcgatacgttctcgcacgtgttggatgatcctcaaccacgg
attccagcccaacagcagaagcaaaaaatcatatccgtggctaccttcaaatatgtggct
aagctaacagtgctggctctcataatgattgtcgctgatttgacttataacatggctttg
tcattgtcaccggcatttgatgttgctttgatgcaaaatactgccattttcgaaattgtc
actttactatatggtgtttgtggaatctccaggaagaactacgttttccgtaatttcctc
atcatgatgaacgcggtcattggaattttgatcatctcatacacgaaggctacctgtgac
atgcttgccggaaagctgtccgtcaaccctaacacgggtgaactttctgacccattcttg
tttgataggttgaaaggtgctctgatttgcggccttggtgctttgattatgggtcctttt
gccgtgttatggaaccgttggttttgcagtaacatttccaagaacgaaaattctgctgta
gtcttggttaagcagagcacccacatggccctaatcggtattattggcatggtaatactt
ttgccatttattcctaaatttccctcccgtgagtctgtggaatccatttcgttgttctat
aatgacaagagcttttggttctctctactaggctcgattatctttggttccttgccgagc
ttgatttcgatattagagttgaatcgcaaggcccctgctgagtatttgacgacgtgcaac
ctgggagctattatctttatggggttagctgagtgggtttgcgaacctacgcaaaccaca
attgtgagatgggaagtcataggatacataatgctaacggtaagtttgttggtcctatca
gtaacactcggggaaggtaaataccaccattag

DBGET integrated database retrieval system