KEGG   Saccharomyces cerevisiae (budding yeast): YBR041WHelp
Entry
YBR041W           CDS       T00005                                 

Gene name
FAT1
Definition
(RefSeq) long-chain fatty acid transporter FAT1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Renin_r
Motif
Other DBs
NCBI-GeneID: 852329
NCBI-ProteinID: NP_009597
SGD: S000000245
UniProt: P38225
Position
II:318266..320275
Genome map
AA seq 669 aa AA seqDB search
MSPIQVVVFALSRIFLLLFRLIKLIITPIQKSLGYLFGNYFDELDRKYRYKEDWYIIPYF
LKSVFCYIIDVRRHRFQNWYLFIKQVQQNGDHLAISYTRPMAEKGEFQLETFTYIETYNI
VLRLSHILHFDYNVQAGDYVAIDCTNKPLFVFLWLSLWNIGAIPAFLNYNTKGTPLVHSL
KISNITQVFIDPDASNPIRESEEEIKNALPDVKLNYLEEQDLMHELLNSQSPEFLQQDNV
RTPLGLTDFKPSMLIYTSGTTGLPKSAIMSWRKSSVGCQVFGHVLHMTNESTVFTAMPLF
HSTAALLGACAILSHGGCLALSHKFSASTFWKQVYLTGATHIQYVGEVCRYLLHTPISKY
EKMHKVKVAYGNGLRPDIWQDFRKRFNIEVIGEFYAATEAPFATTTFQKGDFGIGACRNY
GTIIQWFLSFQQTLVRMDPNDDSVIYRNSKGFCEVAPVGEPGEMLMRIFFPKKPETSFQG
YLGNAKETKSKVVRDVFRRGDAWYRCGDLLKADEYGLWYFLDRMGDTFRWKSENVSTTEV
EDQLTASNKEQYAQVLVVGIKVPKYEGRAGFAVIKLTDNSLDITAKTKLLNDSLSRLNLP
SYAMPLFVKFVDEIKMTDNHKILKKVYREQKLPKGLDGNDTIFWLKNYKRYEVLTAADWE
AIDAQTIKL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccatacaggttgttgtctttgccttgtcaaggattttcctgctattattcaga
cttatcaagctaattataacccctatccagaaatcactgggttatctatttggtaattat
tttgatgaattagaccgtaaatatagatacaaggaggattggtatattattccttacttt
ttgaaaagcgtgttttgttatatcattgatgtgagaagacataggtttcaaaactggtac
ttatttattaaacaggtccaacaaaatggtgaccatttagcgattagttacacccgtccc
atggccgaaaagggagaatttcaactcgaaacctttacgtatattgaaacttataacata
gtgttgagattgtctcatattttgcattttgattataacgttcaggccggtgactacgtg
gcaatcgattgtactaataaacctcttttcgtatttttatggctttctttgtggaacatt
ggggctattccagcttttttaaactataatactaaaggcactccgctggttcactcccta
aagatttccaatattacgcaggtatttattgaccctgatgccagtaatccgatcagagaa
tcggaagaagaaatcaaaaacgcacttcctgatgttaaattaaactatcttgaagaacaa
gacttaatgcatgaacttttaaattcgcaatcaccggaattcttacaacaagacaacgtt
aggacaccactaggcttgaccgattttaaaccctctatgttaatttatacatctggaacc
actggtttgcctaaatccgctattatgtcttggagaaaatcctccgtaggttgtcaagtt
tttggtcatgttttacatatgactaatgaaagcactgtgttcacagccatgccattgttc
cattcaactgctgccttattaggtgcgtgcgccattctatctcacggtggttgccttgcg
ttatcgcataaattttctgccagtacattttggaagcaagtttatttaacaggagccacg
cacatccaatatgtcggagaagtctgtagatacctgttacatacgccaatttctaagtat
gaaaagatgcataaggtgaaggttgcttatggtaacgggctgagacctgacatctggcag
gacttcaggaagaggttcaacatagaagttattggtgaattctatgccgcaactgaagct
ccttttgctacaactaccttccagaaaggtgactttggaattggcgcatgtaggaactat
ggtactataattcaatggtttttgtcattccaacaaacattggtaaggatggacccaaat
gacgattccgttatatatagaaattccaagggtttctgcgaagtggcccctgttggcgaa
ccaggagaaatgttaatgagaatctttttccctaaaaaaccagaaacatcttttcaaggt
tatcttggtaatgccaaggaaacaaagtccaaagttgtgagggatgtcttcagacgtggc
gatgcttggtatagatgtggagatttattaaaagcggacgaatatggattatggtatttc
cttgatagaatgggtgatactttcagatggaaatctgaaaatgtttccactactgaagta
gaagatcagttgacggccagtaacaaagaacaatatgcacaagttctagttgttggtatt
aaagtacctaaatatgaaggtagagctggttttgcagttattaaactaactgacaactct
cttgacatcactgcaaagaccaaattattaaatgattccttgagccggttaaatctaccg
tcttatgctatgcccctatttgttaaatttgttgatgaaattaaaatgacagataatcat
aaaattttgaagaaggtttatagagagcaaaaattaccaaagggtttggatggaaatgac
actattttttggctcaagaattacaagcgctatgaagtcttgaccgctgctgattgggaa
gccatcgatgcacaaacaattaaattatga

DBGET integrated database retrieval system