KEGG   Saccharomyces cerevisiae (budding yeast): YBR043CHelp
Entry
YBR043C           CDS       T00005                                 

Gene name
QDR3, AQR2
Definition
(RefSeq) Qdr3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 BNR_6 NUDE_C
Motif
Other DBs
NCBI-GeneID: 852331
NCBI-ProteinID: NP_009599
SGD: S000000247
UniProt: P38227
Position
II:complement(321876..323945)
Genome map
AA seq 689 aa AA seqDB search
MQAQGSQSNVGSLRSNCSDNSLPNNHVMMHCDESSGSPHSEHNDYSYEKTNLESTASNSR
EHRDNQLSRLKSEEYVVPKNQRRGLLPQLAIIPEFKDARDYPPMMKKMIVFLIAFSSMMG
PMGTSIIFPAINSITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLSELEGRRTTYITSF
ALLFAFNIGSALAPDINSFIALRMLCGAASASVQSVGAGTVADLYISEDRGKNLSYYYLG
PLLAPLLSPIFGSLLVNRWPWRSTQWFMVILSGCNVILLTVLLPETLRKQDSKGAIAQIL
AERRIQVDNNERGEIQEDYQRGEDETDRIENQVATLSTEKHNYVGEVRDQDSLDLESHSS
PNTYDGRAGETQLQRIYTEASRSLYEYQLDDSGIDATTAQVTRIRSTDPKLARSIRENSL
RKLQTNLEEQVKKVLSSNGGEIAPKQVSAVRKVWDTFFVYFIKPLKSLHFLEYPPVALAI
TFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSVTYFFASIYGGRWVDMLLK
RYKEKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCHWVTPLIGTALFGYAAMMT
IGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMLNGMGTGWAFTMLAFIVLG
ASSVLIILKKHGDYWRENYDLQKLYDKID
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcccaaggttcacaatcgaatgtagggtctttgaggagtaattgctctgacaat
tcactaccgaacaatcatgttatgatgcactgcgatgaaagcagcggcagcccgcacagc
gagcacaacgattatagttacgaaaagaccaatctggaaagtacggcatcaaatagtcgt
gaacacagagacaaccagctaagtaggttgaagagtgaggaatacgttgttccaaagaat
caacgtaggggactattgcctcaactcgccattataccggagttcaaggatgccagagat
tatccaccgatgatgaaaaagatgattgtcttcttgattgcgttttcctccatgatgggc
cccatgggcacatctatcatttttccagcgatcaactcaatcacaacagaatttaaaaca
tcagtgattatggtaaacgtttcaattggtgtgtaccttttaagtcttggtgttttccca
ttgtggtggtcttctctatccgagctagagggcagaagaactacttacataacttcattt
gcattattgtttgcatttaatatcgggtctgctctagctcctgatatcaactcatttatt
gccttgagaatgctctgtggggctgcttctgccagtgttcaaagtgtaggtgctggaaca
gtggctgatttatatattagcgaagatagaggtaaaaatttgagttattactatttgggt
ccactactggcgccgctactatctccaatttttggatctttgttagtgaatcgctggccc
tggagatccactcaatggtttatggttattttatccggatgtaatgtcattcttttgacg
gtgttactacctgaaacattaagaaaacaagattctaaaggcgctatcgctcaaattttg
gctgaaagacgtattcaagtagacaataacgaacgtggagagatacaagaagattatcag
aggggagaagatgagacagatcgaattgaaaaccaagttgccacattatctactgagaag
cataactacgttggagaggtaagggatcaagactcgctagatttagaaagtcactctagc
cccaatacttatgatggtcgagctggagaaacccaattgcaacggatttatacagaggcg
agtagaagtctgtatgaatatcagctagatgatagcggtatcgatgcaacaacagcacaa
gttacgagaataagatcaacagatccaaagttagcgagatcgattcgagaaaatagtctg
agaaaattacaaaccaacctggaagagcaagtcaaaaaagtgctatccagtaatggaggt
gaaatcgctcctaaacaggtatcagcggtgaggaaggtctgggacaccttttttgtttat
tttatcaagcctttaaaatcattgcacttcctagaatatccacccgtggcacttgcaata
acattttccgcaatttccttttccacagtatactttgttaatatgacagttgaatataaa
tattcaaggcctccttacaactttaaaccattatacattggtctactgtatattccgaat
tctgtaacatactttttcgcctcaatttacggtggacgttgggtggacatgcttttaaaa
agatacaaagagaaatatggaattcttgctcctgaagctcgtatatcgtggaatgttgtt
acatctgtaatatctttccccattgcgctattgatatttggctggtgcctagataaaaaa
tgccactgggtaacgccactaattggaacagccctctttggatatgcagctatgatgaca
attggtgctaccctttcctatttagtcgattcattgccgggaaagggtgccaccggtgtt
gctttgaataatttaataaggcaaatcttggctgcaaccgcagtctttgtcaccacaccc
atgttaaacggtatgggaactgggtgggctttcacaatgctggcctttatcgtcttgggt
gctagcagtgtacttataatactgaaaaagcacggtgattactggagagagaactacgat
ttacaaaaattgtacgacaaaattgattaa

DBGET integrated database retrieval system