KEGG   Saccharomyces cerevisiae (budding yeast): YBR048WHelp
Entry
YBR048W           CDS       T00005                                 

Gene name
RPS11B
Definition
(RefSeq) ribosomal 40S subunit protein S11B
  KO
K02949  small subunit ribosomal protein S11e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YBR048W (RPS11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YBR048W (RPS11B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YBR048W (RPS11B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17 DUF922
Motif
Other DBs
NCBI-GeneID: 852337
NCBI-ProteinID: NP_009604
SGD: S000000252
UniProt: P0CX47 P0CX48
Structure
PDB: 

Position
II:join(332831..332875,333387..333812)
Genome map
AA seq 156 aa AA seqDB search
MSTELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPF
TGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVG
DIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgaattaactgttcaatctgaaagagctttccaaaagcaacctcacatcttc
aacaatccaaaggtcaagacttccaagagaaccaagagatggtataagaatgccggtttg
ggattcaagaccccaaagaccgctattgaaggttcttacattgataagaaatgtccattc
actggtttagtttccatccgtggtaagatcttgaccggtaccgtcgtctccaccaagatg
caccgtaccattgtcatcagaagagcttacttgcattacattccaaagtacaacagatac
gaaaagagacacaagaacgtcccagtccacgtctccccagctttccgtgtccaagttggt
gacattgttaccgttggtcaatgtagaccaatctccaagactgttagattcaacgtcgtc
aaggtctctgctgctgccggtaaggccaacaagcaatttgctaaattttaa

DBGET integrated database retrieval system