KEGG   Saccharomyces cerevisiae (budding yeast): YBR052CHelp
Entry
YBR052C           CDS       T00005                                 

Gene name
RFS1
Definition
(RefSeq) flavodoxin-like fold family protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red 5_3_exonuc_N
Motif
Other DBs
NCBI-GeneID: 852341
NCBI-ProteinID: NP_009608
SGD: S000000256
UniProt: P38234
Position
II:complement(338720..339352)
Genome map
AA seq 210 aa AA seqDB search
MPKVAILIYSVDDIIATLAENEKKGIEIAGGEAEIFQVPDVSYKTEYATEEGKEAAKVAK
TNADFSYKILTRETLVEYDYYLFGIPTKFGNFPAEWKSFWDSNTGGLWAKGSLHGKIAGL
FVSGAISGKGDTEMCIMNAMSTLVHHGVIYVPLGYKNAYKELTDVEDVNGSCAWGAGCVS
GIDGGRPPSLSELRVHQLQGKAFYDRIKDL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagtcgctattttgatttattcagtggacgatataattgccacattagcagaa
aatgaaaaaaaaggtatagagatagctggtggtgaggctgagattttccaagtgccagac
gtcagctataaaactgaatatgcgacagaagagggaaaagaggcagccaaagtcgccaaa
actaatgcagatttttcctataaaatcctaacaagagaaacgttggttgagtacgattac
tacttattcggaatacctactaagtttggaaacttccccgcggagtggaaaagcttttgg
gactcgaatactggtgggctttgggcaaagggttctctccatggcaaaattgccggtttg
tttgtttcaggcgcaataagcggcaagggtgatacagaaatgtgtatcatgaacgcaatg
agtactctggtccatcatggtgtcatttatgtcccattggggtataagaacgcatacaag
gaattgaccgacgttgaagatgtgaacgggtcttgcgcctggggcgcaggatgtgtttct
ggaatcgacggtggcagacctcccagtttatccgagctaagagttcaccaacttcaaggg
aaggccttttacgaccgtatcaaagatttgtaa

DBGET integrated database retrieval system