KEGG   Saccharomyces cerevisiae (budding yeast): YBR053CHelp
Entry
YBR053C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-GeneID: 852342
NCBI-ProteinID: NP_009609
SGD: S000000257
UniProt: P38235
Position
II:complement(339675..340751)
Genome map
AA seq 358 aa AA seqDB search
MSSVGDFEEIILHDLKPYYHVPGAIHSEGITFVKETGTLLWVDIFKGEVHKVEDIEQPES
SHSFFSISRANYGKNASIEYPPNPDELKESVGCIFPILDGASQNEIKQVLFGSKFGIGKL
DFSKSEWEYVILYSECPELSTDRAYKLRSNDGNVSPDGKYIYVGLMSDFPFDLEPIGCLL
RVDLLAHKIELVWNCLLIPNAIHWDESDQKTMYVTDSLNFTIWKCPGGDLLKRDELIDVK
NSNNQSFESPEPDGSAIWFSKDGKHSGFLFITVWSTSKVQMFDLTNGKLLKEFILPEQTP
RVSCCCFVGKDLFVTTANAEINDAVRTNTDKNGGCIYKIPNVLDGNVPLESTKRQPLH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgttggcgattttgaagaaattattttgcatgatttaaaaccttattatcac
gttcccggtgccatacatagtgaaggaataaccttcgttaaggaaaccggtacactgttg
tgggttgatatttttaaaggagaggttcataaagtcgaagacatagaacagcctgaatcc
agtcattcttttttttccattagtagagccaattatggcaagaatgcgtcaattgagtac
cctcccaatccagatgaattaaaagaatccgtgggctgtatatttccaatacttgatggg
gcttcacaaaatgaaatcaaacaagtattatttggtagtaaatttggcataggaaaattg
gattttagcaaaagtgaatgggaatatgtcattttgtattccgaatgtcctgaattgagt
acagacagagcatataagttgagatctaatgatgggaacgtttcgccagatggaaaatat
atttatgtggggctaatgagcgattttccatttgatttggaacctattgggtgtttgctt
cgtgttgacctattagctcacaagatagagcttgtttggaattgcttgttaattcctaac
gcgatccactgggatgaaagtgatcaaaagacgatgtacgtgactgattctttaaacttc
actatttggaaatgtcctggtggcgacttgctaaaacgtgacgagttaattgacgtgaag
aactccaacaatcaatcttttgagtctcctgaaccagatggaagtgcaatttggtttagc
aaagacggaaaacattctgggtttctgtttatcactgtctggtccaccagtaaggttcaa
atgttcgatttaactaacggaaaattgctgaaggagttcattttgccggagcagacacca
agagtttcatgttgttgttttgttggtaaagatctcttcgtgaccactgccaatgcagaa
atcaacgatgctgtaagaaccaatactgacaagaatggtggctgcatctacaaaattcca
aacgtgctagacggaaatgttcctctggaatctacaaagcgacaacctctccactag

DBGET integrated database retrieval system