KEGG   Saccharomyces cerevisiae (budding yeast): YBR054WHelp
Entry
YBR054W           CDS       T00005                                 

Gene name
YRO2
Definition
(RefSeq) Yro2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_rhodopsin PIRT
Motif
Other DBs
NCBI-GeneID: 852343
NCBI-ProteinID: NP_009610
SGD: S000000258
UniProt: P38079
Position
II:343101..344135
Genome map
AA seq 344 aa AA seqDB search
MSDYVELLKRGGNEAIKINPPTGADFHITSRGSDWLFTVFCVNLLFGVILVPLMFRKPVK
DRFVYYTAIAPNLFMSIAYFTMASNLGWIPVRAKYNHVQTSTQKEHPGYRQIFYARYVGW
FLAFPWPIIQMSLLGGTPLWQIAFNVGMTEIFTVCWLIAACVHSTYKWGYYTIGIGAAIV
VCISLMTTTFNLVKARGKDVSNVFITFMSVIMFLWLIAYPTCFGITDGGNVLQPDSATIF
YGIIDLLILSILPVLFMPLANYLGIERLGLIFDEEPAEHVGPVAEKKMPSPASFKSSDSD
SSIKEKLKLKKKHKKDKKKAKKAKKAKKAKKAQEEEEDVATDSE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattatgttgaactattgaaaagaggtggtaacgaagccatcaaaattaatcca
ccaaccggtgctgatttccacattacatctcgtggttcagactggcttttcaccgttttt
tgtgttaacctactattcggtgtgattttagtcccactaatgtttagaaaaccagttaag
gacagattcgtatattatacggccattgctccaaatttgttcatgtcaattgcttatttc
accatggcttctaacttgggttggatcccagtcagagcaaagtacaaccatgtacaaact
tctacccaaaaggagcacccaggttacagacaaattttttacgctagatacgttggctgg
tttttggctttcccatggccaattattcaaatgtctctacttggtggtactccattatgg
caaattgctttcaatgttggtatgactgaaatatttactgtctgctggttgattgctgcc
tgtgtccactctacttacaaatggggttactacaccattggtattggtgctgccattgtt
gtttgtattagtttgatgacaactacattcaacctggtcaaggccagaggtaaggatgtc
tctaacgttttcattactttcatgagtgtcatcatgtttttgtggctgattgcttaccca
acctgttttggtatcacagatggtggtaacgttttgcaaccagattctgctaccattttc
tatggtattattgatttgttgatcctatctatcttgccagttcttttcatgccattggct
aactatttggggattgaaagattaggtttaatcttcgacgaagaacccgctgaacatgtt
ggtccagttgctgaaaagaagatgccatctccagcttctttcaagtcatctgattctgac
tctagtatcaaggagaagttaaagctaaagaagaagcacaagaaggacaagaagaaggct
aagaaggctaagaaggccaagaaggccaagaaagcccaagaagaggaggaggatgtagcc
accgactctgagtaa

DBGET integrated database retrieval system