KEGG   Saccharomyces cerevisiae (budding yeast): YBR055CHelp
Entry
YBR055C           CDS       T00005                                 

Gene name
PRP6, RNA6, TSM7269
Definition
(RefSeq) U4/U6-U5 snRNP complex subunit PRP6
  KO
K12855  pre-mRNA-processing factor 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YBR055C (PRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YBR055C (PRP6)
Spliceosome [BR:sce03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    YBR055C (PRP6)
 Complex C
   U5 SnRNP specific factors
    YBR055C (PRP6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRP1_N TPR_14 TPR_19 TPR_12 TPR_16 TPR_8 SPO22
Motif
Other DBs
NCBI-GeneID: 852344
NCBI-ProteinID: NP_009611
SGD: S000000259
UniProt: P19735
Structure
PDB: 

Position
II:complement(344602..347301)
Genome map
AA seq 899 aa AA seqDB search
MERPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPK
DDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWM
DIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQ
LTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTN
PQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDVHYCKTLVATAI
NFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEK
ATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDK
LVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYES
ELNNVDQILEKMPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELL
FQTKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFK
IKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERC
LKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPV
RARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKL
FKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGD
TWVWLFRTYARLGKDTVDLYNMFDQCEPTYGPEWIAASKNVKMQYCTPREILLRLMNDK
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggagaggccatcttttttggatcaagaaccacctgcaggttacgtaccaggtattggt
cgtggagccactggattttcaacaaaagaaaagcaagtggttagtaatgatgacaaagga
agaagaataccgaaaaggtaccgtgaaaatttgaacaaccatcttcaaagccaaccgaaa
gatgatgaagatgatgaagctgcaaatgtattcaaaacgcttgaattgaaattagcacaa
aagaaaaagaaaagagctaatgaaaaggatgatgacaattcagttgattcttcaaacgtg
aaacggcaatttgccgatttgaaagaatcattagctgctgtaacggagagtgagtggatg
gatattccggatgccacagattttacaagaagaaacaagagaaatagaattcaagagcaa
ttaaacagaaaaacttatgctgcaccggattcgctaatacctgggaatgttgatttaaat
aaattaacggaagaacgagaaaaattattgcaatctcaaatagatgagaatcttgcacaa
ttaacgaagaatgcaagtaaccctatacaggttaataaaccgaacgctgctaccgatgcc
ctaagttacttaaaggacttagaaaacgatagagtaaattctctctcagacgcaacgtta
gaagatttacagaaaatgcgcacaattttaaagtcatacagaaaggccgatccaacaaat
ccacagggttggatagcttctgccagattagaagaaaaggcaagaaaattttcagtagca
aaaaaaataatagaaaatggttgccaagagtgccctcgaagctccgatatttggctagaa
aacattagactacacgaatctgatgttcactactgtaaaacattagtggcaacggcaata
aattttaatccaacgtctccgcttctttggttcaaagctattgatttggaaagcacaacg
gttaacaaatatagagtagtgagaaaagcactgcaagagattcctcgagatgagggccta
tggaagctagctgtcagttttgaagctgacaaagcgcaagttataaaaatgttagagaaa
gccacacaatttattccacaaagtatggatctcttgactgcatatactaatttgcaaagc
tatcataatgctaaaatgactttgaattccttcagaaaaatccttccgcaagaaccggaa
atttggattatctctacactcttggaagaacgaaataacccagatatacctgtagataaa
ctagttagtttgctcaaggagggtttattggaactctctaaaaatgggtacaaagcgacc
ttgtcagcatggttgaaacgtgcagaggctctaaatgatgcgcccaattcaaatttaacc
tgtcaagccatcgtttacgctatattagaatggttaagagaaagtggcgagtatgagtct
gagttgaataatgttgatcagatattagaaaaaatgccacactcaaaggtacaaattgct
gtcttaaaaaagcttattcagtgggatccttgtgatacagttctttggtctagactgaaa
atggccactgaaagctaccataaaattgaagagttattagcatttttccaggagctgcta
tttcagaccaagaatagtgatgatatacgagcaaatatgagggagaaaagccctggcttg
ttaatgatgtatgtaagcgaatattggaaggcccaaaaaggggatactaggcaaacacta
gttttgattgaccagattatagatttcgccccgcataatttggatttacgctttttcaag
ataaagttattaggtcgttcactacaacttgatgaattacgagatttttttcagcaaact
ttctcctctttagaggattttaagatcagtggcacggaaagattatattataaatacgta
aactttctgcggtaccaagatctgaatgaagaggctataaaattcttgaatgagagatgt
ttgaaatcatttcccatctgccacaaattttttttacagctgggtcaaatttatcattcc
atgggcaatattgaaatgagtagagaaacctatttgtctggtacaaggttagtgcccaat
tgccctttattatgggtttccctatcaaagattgacgagattgatctaaaaaatccagta
agggcaagatcaattttagatagaggattgttaaaaaatcctgacgatgtattattttac
attgctaaaatccaaatggaaataagacttggtaacttagatcaggcggagttactcgtc
acacaggcattgcaaaagtttccaagcaatgctttactttgggtggagcaaatcaagctg
tttaagcatggaaacaaaagttcgttaaaaaaaacaatttttcaagatgctttaagaagg
acacaaaacgatcatcgcgttcttttggagattggagtatccttttatgcagaagcgcaa
tatgaaacatcattaaaatggttagaaagagctctgaaaaagtgctcgcgttacggagat
acatgggtttggctatttaggacatatgcaaggttaggcaaggatactgttgatctctac
aatatgttcgatcaatgtgagcctacttacggacccgaatggatagccgcctccaagaac
gtaaaaatgcaatactgcacacctagagagattttattgcgcttgatgaatgacaaataa

DBGET integrated database retrieval system