KEGG   Saccharomyces cerevisiae (budding yeast): YBR057CHelp
Entry
YBR057C           CDS       T00005                                 

Gene name
MUM2
Definition
(RefSeq) Mum2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wtap
Motif
Other DBs
NCBI-GeneID: 852348
NCBI-ProteinID: NP_009613
SGD: S000000261
UniProt: P38236
Position
II:complement(352193..353293)
Genome map
AA seq 366 aa AA seqDB search
MNYMAYDYDPQHSLETSFNNLAFHPHQQSQQQALYESGERNDARPGLMNTLGQASKMNNS
MLPQGSSASPLTGQHSLNSTTNFNMPPSMNTYNYQNVPQASMRNTLNHNNIMNGATANDY
WLDPMNNMTNNKDTNGNPNDSMSSMSNMTAKTSINSTAFKNSFVPFNHVTALSMNNVNSN
EMNSNKDDRMEALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQ
TFELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIA
HKMVVRLENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLASKESS
KEDVAN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatggcttatgattatgatccccaacattcgttggaaacgtcctttaacaat
ttggcatttcatccccaccaacagtcacagcaacaagccctatacgaatctggtgaaaga
aacgatgccaggccgggattaatgaacaccttaggtcaggcgagtaaaatgaataattcc
atgcttcctcaaggttcgtcggctagtcccttaacgggtcaacatagcttgaacagtaca
acaaatttcaacatgcccccatcaatgaatacctataattaccagaatgtaccacaagca
tctatgagaaatactctcaatcataacaatatcatgaatggggcaactgctaatgattat
tggctggatccaatgaataatatgacaaataacaaggatactaatgggaatcctaatgac
tcgatgtcatcaatgtctaatatgaccgctaaaacctcaatcaatagtacggcattcaag
aattcatttgttccttttaatcatgtgacagcgctctcaatgaataatgtcaacagcaat
gagatgaattcaaataaagatgacagaatggaagcattggaagtagaactacaaataaag
gaaagtcaaatcgaatcactcgagaacgaaattcaaaggctaaagaaaattttcaacgag
gggctaaactacaagcagaatgagcataagtatgagaaggaaaactgccatataccccaa
actttcgaattgccagcttccttggaagtgatattcagaaaactgtcatcgtcactgcat
gcaaaggaaaaggagttagcagagacgaaagaaaatctggaaagtatattaactgcactg
gcgctaaatccaacaaattcagtgactaagtatggcaggtatgatgcagaatcgattgct
cacaaaatggtggtaagattagaaaacttaacaaacgagaacaaagaaatggccaagatg
ttagcatatggcagatcaaaagagacccaaattgaactgcagttggccaaaaaagaaaat
ctagaattaagagaaaaaatcgcatctttggaagcccatttggcttcaaaggagtcttca
aaggaggacgttgctaattga

DBGET integrated database retrieval system