KEGG   Saccharomyces cerevisiae (budding yeast): YBR059CHelp
Entry
YBR059C           CDS       T00005                                 

Gene name
AKL1
Definition
(RefSeq) serine/threonine protein kinase AKL1
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YBR059C (AKL1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YBR059C (AKL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 852351
NCBI-ProteinID: NP_009615
SGD: S000000263
UniProt: P38080
Position
II:complement(356861..360187)
Genome map
AA seq 1108 aa AA seqDB search
MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNE
FDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRD
GVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHR
DIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLY
RCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIML
AENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQ
KKIMQNNKLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKES
QSDQRKSTLSEDKSSRTTSNANSSGTANNPQEINTIQSPGIEDKSIFENKTPGELYYPSV
SELDTYLDKELVKQSSDPTISEQSPRLNTQSLPQRQKSTSSYSSGGRSMKSTSYGAATIG
SDEALANEKTAGINKMKQHKSNNPFPKMNVAYHSTNELSNDASNFFLEEQQQGQRYQQAQ
NQTGTQGNTFPDESQYQSRVEQQQQQQDQPKGPANYSQRNFYTGRDRSNKPMQLGGTIAG
DSGNRRVNFQNISQNYATNSQSGYLPSQNSPAIPMVRPVISMNQQQAQQIQAQQLQAQQM
QAKQQMQAKQQMQVQQQLQVQQQMQIQNANNNGTYVSDRTNHTTEDMRNAQGGEPPILAG
NSANEPMHSSSKNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRN
GVLNLSLNEMDLSRDDTGAAVSSFSSSSSSASIQQAKLSGRKGSSKRNNYSTDELGDSMV
SSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQS
LDLNFQEVNLSSPTLTQEHRNKNDSPAPNSHHSYRVSPHASTAITENKRHSTGHELSTRS
NGKHETHRTGSKQRHDLERYRHSKDKDSNSSITISTSTPSEMRKSFARARQSLDLERVRR
EAMASSASSSGGSNGKRRSFFSVFRSEK
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcacgaatggtacttctagaagcgtttcggcaatgggccatccggcggtagag
aggtacactccaggccatattgtctgcgtaggcacacataaagttgaagtggtaaattat
ttagcagaaggtggctttgctcaaatttacgtggtgaaattcctagagtatcttaatgaa
tttgataatacagcaagtgttcccttaaagattggcgatgtcgcatgtctgaaaagagta
ttagttcaagatgagaatggattgaacgagatgagaaatgaagtggaggtaatgaagaaa
ttgaaaggggccccaaatatagtacaatacttcgattccaacgcctctcgccgtcgtgat
ggcgttcaaggatttgaggttcttttgctaatggaattgtgtccaaacaaatctttgcta
gattatatgaaccaacgattgtcaacgaaactgacagaagctgaaattgtgaaaattatg
tatgacgttgctctttctatctctcaaatgcactaccttcctgtgtccttgatccatcgc
gatatcaagattgaaaatgtcttggtagatgccaaaaacaatttcaagctagctgatttt
gggtccacgtcgacatgtttcccaattgtcactactcatcaagatattgctcttttgact
caaaacatctatgtgcatactactccgcagtataggtcccctgaaatgattgacctttac
agatgtctgcccattaacgaaaaatcagacatatgggctttgggagttttcctttacaaa
ttattatttttcaccaccccttttgaaatgacaggtcaatttgctatattacattccaaa
tatgaatttcctgtcaacaaatattcatcaaaactaatcaacttaatcattatcatgttg
gcggaaaacccaaatttgagaccgaacatttatcaagtattataccatttatgtgagatt
ttaaatgtggaagttccaatcgaggataagtatgcggaaggtgcctataatttttctaaa
tatacgcagtttcagaataaattacaaaatgttcaattgcaaatgtaccagctacaacaa
aagaaaattatgcagaacaataaattgagtgactcagaagaaaacttactgaatgacatg
tttctttcttcttttgaaatctcatccaaacttcccatgaacgctagtgacggtcatgcc
gctgtttctagaataccatctcaaaatgtcggccaagaacttgaagaagagaaagaaagt
caatccgatcagaggaagtctaccctgtccgaagataaatcgtcaagaacaacatcgaat
gctaacagttctggtacagccaataatcctcaagaaatcaatacaatccagtctccaggt
atagaggacaaatcaatttttgaaaataaaactcctggagagttatattatccaagcgtg
agcgaattagatacttatttggacaaagaattggtcaaacaatcaagtgatccgactatt
tctgaacaaagtcctcgtttgaatacccaatcactaccacagaggcaaaagagcacaagc
tcttattcttcaggtggcagatcaatgaagagcacatcatatggtgcagcaacgatcggg
tcagacgaagccttggcgaacgagaaaactgctggtattaataagatgaaacaacataaa
tcgaataatccctttccaaaaatgaatgttgcataccattctacgaatgaattgagcaat
gacgcaagtaactttttcctggaagaacaacagcaaggccagagatatcagcaagctcaa
aatcaaacaggtacacaagggaatacctttccagatgaatctcagtatcaatctagagtt
gaacaacagcagcaacaacaggaccaacccaaaggacctgctaattatagccaaagaaat
ttctacactgggagggatcggtccaataaacctatgcagttgggtggaactattgctgga
gatagtggtaatagaagagtcaactttcagaatatttctcaaaattacgccacgaactcc
cagtcaggatatctcccaagtcaaaattccccagcaattccaatggtgagacctgttatt
tccatgaatcagcagcaagcgcaacagatacaagcccagcaattgcaggcacaacagatg
caggcaaagcaacagatgcaagccaagcagcagatgcaagttcagcaacaactgcaagtc
caacagcaaatgcaaattcaaaatgcaaataataatggtacttacgtctctgatagaaca
aatcataccacagaagatatgagaaatgctcaggggggtgaacctccaattcttgcagga
aattctgcaaatgaaccaatgcactcatcctctaaaaatgaagctctcttaattgaacta
tctccattaaaagaagatgcaggaaagcaatctttccaagatacaaatgagcctcaaact
ggcggtatcgaagatgccggcggttcaggaactatcaaaggctcgaacaataatcgaaat
ggcgttttaaatttaagtttgaatgagatggacttatcaagagatgatactggtgctgct
gtctcctccttttcatcgtcttcatcgtctgcatcaattcaacaagctaagctttctgga
cgcaaaggttccagtaagaggaacaattattcaacagacgaattgggagatagtatggtc
tccagcgaaagcattgatattgatttggatgatgcaaggagaggaaaaacagctgaaaga
agaccactccataatgaaagaggtcataaagaccaggcaagatcaagtgatgctagtaag
tctaatcaattcaaaagcaaggacttcagcagcgtatcaacaaggcaaccgcggcagtca
ttggatctgaatttccaggaagtaaatctgtcttcaccaacgttaactcaagagcataga
aataaaaacgactcgccagcaccaaattcacatcactcgtatagagtttcacctcatgct
tccaccgcaataactgagaataagcgccacagtactggtcacgaactgtcaacccggtca
aatggcaagcatgaaacacacaggactggttccaagcaaaggcacgatttggaaagatac
cggcattcgaaggataaggatagcaatagcagcattactattagcacctcaactccatca
gagatgagaaaatccttcgctagggcccgtcaatcgcttgatttggaaagggtccgtcgt
gaagcgatggcaagtagtgcatccagtagtggtggcagtaacgggaaaaggagatctttt
ttctcagtctttagaagcgagaaatga

DBGET integrated database retrieval system