KEGG   Saccharomyces cerevisiae (budding yeast): YBR063C
Entry
YBR063C           CDS       T00005                                 

Definition
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Other DBs
NCBI-GeneID: 852356
NCBI-ProteinID: NP_009619
SGD: S000000267
UniProt: P38083
Position
II:complement(366970..368184)
AA seq 404 aa
MEELGLKSTFPYEYGSDFTMIRTEMLNTTKSETTILFSNIKSILAIIWKYSFTFLRSFSD
SIKLIIDDVVTIGSRNFAERLQIEAKKNNDQEDIWASTIILGVIIGYLISSIKRKNTFPI
MPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQ
NMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLLDSANETPFK
GIEKSINETMVKVPMGCDVSLSHYGRQYAPGNISIMRSFTARDNTKSVSREIRDICKSFL
IIKSQFGDELFLTMFMEKPVFFDNNIPIEITGAYREKRERLDEVIHKDLIRYDEVQNLTR
IRNLLRVKSQKICSRRHNSSVPTKKLLVNDKGATSILLWYSNYS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggaggaactaggtttaaaaagcacttttccatatgaatatggctcagactttacaatg
ataagaacggaaatgttaaatactacgaagagcgaaacaactattttattttccaatata
aagagcattttggccattatttggaaatactcatttacatttttaagatctttttccgat
tccatcaaacttattattgacgatgttgtcactattggctcccgaaattttgcagagaga
ttacagattgaagcgaaaaaaaacaatgaccaagaagatatctgggcatccacaataatt
ttgggtgtgattatcgggtatttaatctcttctattaagagaaagaacacttttccaata
atgcctacgagctcacctaaaatagatgattgtaggttcaagactggtgataccatatcc
attgtaataaactttaatgaagactgcctcaataatcgaagtgacgttaccgaagagaga
aattatgaggaatccacagttttacattcaaaggagtcagttctcagcattggtaggcaa
aatatggtaactttgaaccaaagcgatgaaaatttcacctatggcaattttgatgagtac
gacttattaactaaagattatacaacagaggtcttaacgcgatcacctggctcgaatccc
gagtttaaagcagtggtaaataatacattacttgatagcgcgaatgaaacgccgtttaaa
ggtattgaaaaaagtattaacgaaacaatggttaaagttcctatgggatgcgatgtatct
ctctcccattatggcagacaatacgcgcctggaaatatttcaattatgagaagcttcact
gctcgagataatactaaatctgtgagtagagaaattcgtgatatctgtaaatcgtttttg
attataaaaagccaatttggtgacgaacttttcctgactatgttcatggaaaaaccagtt
ttctttgataacaacatcccaattgaaataactggagcataccgagaaaaacgagagcga
ttagatgaagtgattcataaggatcttatccgctatgatgaagttcaaaatttgacaagg
attcgcaatttgctccgggttaaaagtcaaaagatttgttccaggagacataatagttcg
gttcccacaaaaaaattgttagttaatgataaaggcgcaacttcgattctactgtggtac
tctaactattcatag

DBGET integrated database retrieval system