KEGG   Saccharomyces cerevisiae (budding yeast): YBR085W
Entry
YBR085W           CDS       T00005                                 

Gene name
AAC3, ANC3
Definition
(RefSeq) ADP/ATP carrier protein AAC3
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YBR085W (AAC3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YBR085W (AAC3)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YBR085W (AAC3)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YBR085W (AAC3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 852380
NCBI-ProteinID: NP_009642
SGD: S000000289
UniProt: P18238
Structure
PDB: 
4C9Q 4C9J

Position
II:415983..416906
AA seq 307 aa
MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV
DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNL
ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR
GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTV
RRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMI
LFGKKFK
NT seq 924 nt   +upstreamnt  +downstreamnt
atgagtagcgacgctaagcaacaagaaacaaactttgccattaatttcttaatgggtggt
gtgagtgcggccatcgctaaaactgctgcctcaccaatcgaaagagtcaagatcttgatc
caaaatcaagatgaaatgatcaagcaaggaactttagataaaaagtattccggtatcgtg
gattgtttcaagagaactgcaaagcaagagggactaatatccttttggcgaggaaatact
gccaatgttattcgttattttcccactcaagctttgaacttcgccttcaaagataagatt
aagttgatgtttggtttcaagaaagaggaaggctatggtaaatggtttgcaggtaatctg
gcttctggtggtgcagctggtgctctttcgttattatttgtttattctttagattttgcc
agaaccagacttgctgctgatgcaaaatcgtcgaaaaagggtggcgctcgccaattcaat
gggttgactgatgtttataaaaagaccttgaaatcggatggtatcgcaggattatacaga
ggattcatgccatcagtagtgggtatcgtggtttatagaggactatatttcggtatgttt
gattctctcaagccactggtgctaactggttcattagatggttcattcttggcttcattt
ttattgggatgggtggtcactacaggtgcctcaacatgttcttatccattagacacagtg
agaagaagaatgatgatgacttcaggtcaagcagtaaagtacaacggtgctatagattgt
ctcaaaaaaatcgtagcttctgaaggtgtagggtcattgttcaaaggctgcggggcaaat
atcttgagaagtgttgctggagctggtgttatttccatgtatgaccagttgcaaatgata
ttgttcggtaaaaaattcaaatga

DBGET integrated database retrieval system