KEGG   Saccharomyces cerevisiae (budding yeast): YBR089C-AHelp
Entry
YBR089C-A         CDS       T00005                                 

Gene name
NHP6B, YBR090C-A
Definition
(RefSeq) high-mobility group nucleosome-binding protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_box HMG_box_2 YABBY
Motif
Other DBs
NCBI-GeneID: 852386
NCBI-ProteinID: NP_009647
SGD: S000002157
UniProt: P11633
Position
II:complement(426190..426489)
Genome map
AA seq 99 aa AA seqDB search
MAATKEAKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRI
LGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaactaaagaagcaaagcaaccaaaggaaccaaagaagaggaccaccaggaga
aagaaggatcctaacgcccctaagaggggcttgtcagcttatatgttctttgctaatgaa
aacagagacattgtccgttccgagaatcctgacgtaacttttggccaagtaggcagaata
ttgggtgagaggtggaaggccttaactgctgaagaaaagcaaccctatgaatctaaggct
caagcagacaagaagagatacgaatctgaaaaggaattgtacaatgctacacgtgcttga

DBGET integrated database retrieval system