KEGG   Saccharomyces cerevisiae (budding yeast): YBR098WHelp
Entry
YBR098W           CDS       T00005                                 

Gene name
MMS4, SLX2, YBR100W
Definition
(RefSeq) Mms4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ERCC4 Clusterin
Motif
Other DBs
NCBI-GeneID: 852395
NCBI-ProteinID: NP_009656
SGD: S000000302
UniProt: P38257
Position
II:441515..443590
Genome map
AA seq 691 aa AA seqDB search
MSQIVDFVEDKDSRNDASIQIIDGPSNVEIIALSESMDQDECKRAHVSSAEMIPSSPQRK
SVSNDVENVDLNKSIELSAPFFQDISISKLDDFSTTVNSIIDSSLRNENNAKGNAKKLLD
DLISDEWSADLESSGKKHNKSQYNLRDIAEKWGVQSLKNPEPIAVDCEYKTQGIGKTNSD
ISDSPKSQIGAADILFDFPLSPVKHENPTEEKHNSIANENSSPDNSLKPAGKQNHGEDGT
SMAKRVYNKGEDEQEHLPKGKKRTIALSRTLINSTKLPDTVELNLSKFLDSSDSITTDVL
STPAKGSNIVRTGSQPIFSNANCFQEAKRSKTLTAEDPKCTKNTAREVSQLENYIAYGQY
YTREDSKNKIRHLLKENKNAFKRVNQIYRDNIKARSQMIIEFSPSLLQLFKKGDSDLQQQ
LAPAVVQSSYNDSMPLLRFLRKCDSIYDFSNDFYYPCDPKIVEENVLILYYDAQEFFEQY
TSQKKELYRKIRFFSKNGKHVILILSDINKLKRAIFQLENEKYKARVEQRLSGTEEALRP
RSKKSSQVGKLGIKKFDLEQRLRFIDREWHVKIHTVNSHMEFINSLPNLVSLIGKQRMDP
AIRYMKYAHLNVKSAQDSTETLKKTFHQIGRMPEMKANNVVSLYPSFQSLLEDIEKGRLQ
SDNEGKYLMTEAVEKRLYKLFTCTDPNDTIE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatcgttgattttgttgaggacaaagattcaagaaacgatgccagtattcag
atcatcgatggaccctcaaatgttgaaattatcgctctctcggaatcaatggatcaagat
gagtgcaaaagggcacatgtaagctctgcagagatgattccatcatcaccgcaaagaaaa
tctgtttcgaatgatgttgagaatgttgacctaaacaaatctatcgaactttctgcgccg
ttcttccaagatatcagtataagcaagctagatgacttttctacaacagtaaattccatc
atagattcgtctctcagaaatgagaataatgcaaaaggaaacgcgaaaaaacttttggat
gatctaataagtgatgaatggtcagctgatcttgagtcgagtggaaagaagcacaacaaa
tcacaatacaatttgagggacatcgcagagaaatggggagtacagtctttaaaaaatcca
gagcctattgctgttgactgcgaatataagacacaaggaatcggaaaaaccaatagtgac
attagtgatagtccgaaatcacagataggagcagctgatatactgttcgattttccactg
tctccagtaaaacatgagaacccaactgaagaaaagcacaattcgattgctaatgaaaat
tcttcaccagataatagcctgaaaccagcaggaaaacaaaatcatggtgaagatgggaca
tccatggcaaaaagggtatacaataaaggtgaagacgagcaagaacaccttccgaaagga
aagaagagaaccatagcgttatcaagaacactaatcaacagcaccaaactacctgataca
gtagaactaaatctttctaaatttctcgattcctcagatagtattactactgatgtactt
tcaacccctgcaaaggggtctaacatagtaaggacaggtagtcaaccaatctttagcaac
gctaattgttttcaggaagcaaaacgctcgaaaacattaacggctgaggatcccaaatgt
actaaaaatactgccagagaggtatcacaactagagaattatattgcctatgggcaatac
tatactagagaagactcaaaaaacaaaatacgacacttgttaaaagaaaacaaaaatgct
tttaagcgagttaaccagatatatcgagataatataaaagcacgctctcaaatgattata
gagttttcgcctagccttctccagttatttaaaaaaggagacagtgatctgcaacaacaa
ttggcaccagcagttgtgcaatcaagctataacgattctatgccgcttttaagatttctt
cgaaaatgtgacagtatttacgactttagtaacgatttctattacccctgtgatcccaaa
atagttgaagaaaacgttttgattctatattatgatgcgcaagaattttttgaacaatac
acttcacaaaagaaagaattatataggaagatacgatttttctcaaagaatggaaaacat
gtgattcttatactaagcgatataaataaactcaaaagagctattttccaattagaaaat
gaaaagtacaaagctagggtagaacaacgattgtcaggaacagaagaagctttaagaccg
agaagtaaaaaatcaagccaagttggaaaattagggataaaaaaatttgatttagagcaa
cgattgcgcttcattgatagagaatggcatgtcaaaatacatactgtaaattcacatatg
gagtttattaattctctgccgaacctagtgtcattaattggaaaacagcgcatggatccc
gcaattcggtatatgaaatatgctcatttgaatgtaaaatccgctcaggatagtacagaa
acgctaaagaaaacctttcatcagatagggagaatgcctgaaatgaaggcgaataatgtc
gtgagcctataccccagttttcaatcattacttgaagatattgaaaagggaagactgcaa
tcagacaacgaaggtaaatacttgatgactgaggcagtagaaaaaagattgtacaaactg
tttacttgtactgatccaaatgatactattgaatga

DBGET integrated database retrieval system