KEGG   Saccharomyces cerevisiae (budding yeast): YBR104W
Entry
YBR104W           CDS       T00005                                 

Gene name
YMC2
Definition
(RefSeq) organic acid transporter
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YBR104W (YMC2)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YBR104W (YMC2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 852401
NCBI-ProteinID: NP_009662
SGD: S000000308
UniProt: P38087
Position
II:449667..450656
AA seq 329 aa
MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV
RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN
ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR
EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW
KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG
FGPTMVRSAPVNGATFLTFELVMRFLGEE
NT seq 990 nt   +upstreamnt  +downstreamnt
atgagtgaagaatttcctacgccgcagcttttggatgaattggaagatcaacagaaagtt
accacgccgaatgagaagagagagttaagttctaatcgtgtgttgaaggatatttttgcg
ggtaccatcggtggtattgcacaagttcttgtagggcaaccgtttgatacaacaaaagtt
aggcttcaaacagccaccacaagaacaacaacgttggaggtattgcgtaacttggtaaag
aatgagggtgtgtttgcattctacaaaggtgcgttaacaccgttattgggtgttggtata
tgtgtctcagtacaatttggtgtgaatgaggcgatgaaaagatttttccaaaattacaac
gcttctaagaacccgaatatgagctcacaggacgtagatctttcacgttcaaatactctg
ccactatcccagtactacgtttgtgggttgacaggtggtgtagtcaattcattcttggca
tcgcccattgaacaaataagaattcgtttgcagacgcaaacatctaatggtggagacaga
gaattcaaaggtccttgggactgtattaaaaaattgaaagctcaaggtggattgatgagg
ggtttatttcccacaatgataagagccggacatgggcttggtacatattttcttgtctac
gaagcattggttgccagagaaattggtacgggactaacaagaaacgaaattcctccttgg
aaattatgcttatttggtgcattttccgggacaatgttgtggttgacagtatacccattg
gacgttgtgaaatccattatacaaaacgatgatttacgaaaacctaaatacaagaattcc
atttcttacgtagcaaagaccatttatgcaaaagaaggtatcagagcctttttcaaaggg
tttgggccaacaatggttaggtccgcgcccgttaatggtgcgacattcctgacgtttgaa
ttagtcatgagatttctgggggaagagtag

DBGET integrated database retrieval system