KEGG   Saccharomyces cerevisiae (budding yeast): YBR118WHelp
Entry
YBR118W           CDS       T00005                                 

Gene name
TEF2
Definition
(RefSeq) translation elongation factor EF-1 alpha
  KO
K03231  elongation factor 1-alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBR118W (TEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YBR118W (TEF2)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YBR118W (TEF2)
   03012 Translation factors [BR:sce03012]
    YBR118W (TEF2)
   04131 Membrane trafficking [BR:sce04131]
    YBR118W (TEF2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YBR118W (TEF2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     YBR118W (TEF2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    YBR118W (TEF2)
Translation factors [BR:sce03012]
 Eukaryotic type
  Elongation factors
   YBR118W (TEF2)
Membrane trafficking [BR:sce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    YBR118W (TEF2)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YBR118W (TEF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4
Motif
Other DBs
NCBI-GeneID: 852415
NCBI-ProteinID: NP_009676
SGD: S000000322
UniProt: P02994
Structure
PDB: 

Position
II:477671..479047
Genome map
AA seq 458 aa AA seqDB search
MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL
DKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGV
GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVG
YNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPT
DKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQG
VPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLD
CHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLG
RFAVRDMRQTVAVGVIKSVDKTEKAAKVTKAAQKAAKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagagaagtctcacattaacgttgtcgttatcggtcatgtcgattctggtaag
tctaccactaccggtcatttgatttacaagtgtggtggtattgacaagagaaccatcgaa
aagttcgaaaaggaagccgctgaattaggtaagggttctttcaagtacgcttgggttttg
gacaagttaaaggctgaaagagaaagaggtatcactatcgatattgctttgtggaagttc
gaaactccaaagtaccaagttaccgttattgatgctccaggtcacagagatttcatcaag
aacatgattactggtacttctcaagctgactgtgctatcttgattattgctggtggtgtc
ggtgaattcgaagccggtatctctaaggatggtcaaaccagagaacacgctttgttggct
ttcaccttgggtgttagacaattgattgttgctgtcaacaagatggactccgtcaaatgg
gacgaatccagattccaagaaattgtcaaggaaacctccaactttatcaagaaggttggt
tacaacccaaagactgttccattcgtcccaatctctggttggaacggtgacaacatgatt
gaagctaccaccaacgctccatggtacaagggttgggaaaaggaaaccaaggccggtgtc
gtcaagggtaagactttgttggaagccattgacgccattgaacaaccatctagaccaact
gacaagccattgagattgccattgcaagatgtttacaagatcggtggtattggtactgtg
ccagtcggtagagttgaaaccggtgtcatcaagccaggtatggttgttactttcgcccca
gctggtgttaccactgaagtcaagtccgttgaaatgcatcacgaacaattggaacaaggt
gttccaggtgacaacgttggtttcaacgtcaagaacgtttccgttaaggaaatcagaaga
ggtaacgtctgtggtgacgctaagaacgatccaccaaagggttgcgcttctttcaacgct
accgtcattgttttgaaccatccaggtcaaatctctgctggttactctccagttttggat
tgtcacactgctcacattgcttgtagattcgacgaattgttggaaaagaacgacagaaga
tctggtaagaagttggaagaccatccaaagttcttgaagtccggtgacgctgctttggtc
aagttcgttccatctaagccaatgtgtgttgaagctttcagtgaatacccaccattaggt
agattcgctgtcagagacatgagacaaactgtcgctgtcggtgttatcaagtctgttgac
aagactgaaaaggccgctaaggttaccaaggctgctcaaaaggctgctaagaaataa

DBGET integrated database retrieval system