KEGG   Saccharomyces cerevisiae (budding yeast): YBR132C
Entry
YBR132C           CDS       T00005                                 
Symbol
AGP2
Name
(RefSeq) Agp2p
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YBR132C (AGP2)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YBR132C (AGP2)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 852429
NCBI-ProteinID: NP_009690
SGD: S000000336
UniProt: P38090
Position
II:complement(499652..501442)
AA seq 596 aa
MTKERMTIDYENDGDFEYDKNKYKTITTRIKSIEPSEGWLEPSGSVGHINTIPEAGDVHV
DEHEDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPA
SLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQ
IPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALG
LFTFTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTI
AGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEA
RPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKI
FTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLF
FRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYL
MVFINIGIYVGYKFIWKRGKDHFKNPHEIDFSKELTEIENHEIESSFEKFQYYSKA
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgacaaaggaacgtatgaccatcgactacgaaaatgacggtgattttgagtacgataag
aataaatacaagacaataaccactcgaataaagagtatcgaacctagtgagggatggttg
gaaccttctgggtcagtgggtcacataaacacgatacccgaagcgggcgatgttcacgtg
gatgaacatgaggatagagggtcttctattgatgatgactcaaggacttacctgctatat
ttcacagaaactcgacgtaaactagaaaacaggcacgtccagttgattgctatttccggt
gtcattggtacggcgctattcgtggcgatcggaaaagctttataccgtggagggcccgcc
tctttattattggcatttgctctttggtgtgttccaatactttgcattactgtgtctaca
gcggaaatggtctgctttttccctgtaagttccccctttttgagattagcaacgaagtgc
gttgacgattcattggctgtcatggctagctggaatttctggtttcttgaatgcgtacag
atccctttcgagattgtttctgttaatacaattatacattattggagagatgattattca
gctggtattccgctcgccgttcaagtagttttgtatctgcttatttccatttgtgcagtc
aaatattacggtgaaatggaattttggttggcttctttcaaaattatccttgcactcggc
ctatttacattcacgttcattaccatgttgggtggaaatcctgaacatgatcgttacggg
tttcgtaattatggtgaaagtccattcaagaaatactttcccgatggcaatgatgtgggg
aagtcttcgggctacttccaggggtttctcgcttgcttgattcaggcatcgtttaccata
gctggtggcgagtatatttctatgttagcgggagaggtcaaacgaccaagaaaagtatta
cccaaggcgtttaagcaggtgtttgtgagattaacatttttgtttttagggagttgtctg
tgtgttgggattgtttgttcgccaaatgatcctgacttgacagcagcaattaatgaagca
aggcctggcgccgggtcttcaccttatgtcattgcaatgaataatctgaaaattagaata
ttacctgacattgttaatatagctttgattacagccgccttttctgctggtaacgcttac
acttattgctcatccagaacattttatggtatggcattagatggctacgcgccaaaaatc
ttcactagatgcaataggcatggtgtgcccatttactctgtggccatatctttggtatgg
gctttagtgagccttttgcaactgaattctaatagtgcggtcgtattgaattggttaatt
aacttgattactgcctctcaattgattaattttgtcgtcctttgtatcgtctatttattt
ttcagaagggcttaccacgtccaacaagattcgttacccaagttgccattccgttcgtgg
ggtcaaccatacactgctattatcggccttgtttcatgttccgcaatgattttaatacag
ggctacaccgttttctttcccaaattatggaacacacaagattttttgttttcgtattta
atggtgtttatcaacatcggtatatatgtgggctacaaatttatttggaaacgtggtaaa
gatcacttcaaaaacccacatgaaattgacttttctaaagagctaacagaaattgaaaac
catgagattgaaagctccttcgaaaaatttcaatattatagcaaagcataa

DBGET integrated database retrieval system