KEGG   Saccharomyces cerevisiae (budding yeast): YBR143CHelp
Entry
YBR143C           CDS       T00005                                 

Gene name
SUP45, SAL4, SUP1, SUP47
Definition
(RefSeq) translation termination factor eRF1
  KO
K03265  peptide chain release factor subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YBR143C (SUP45)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YBR143C (SUP45)
   03012 Translation factors [BR:sce03012]
    YBR143C (SUP45)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     YBR143C (SUP45)
Translation factors [BR:sce03012]
 Eukaryotic type
  Release factors
   YBR143C (SUP45)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eRF1_2 eRF1_3 eRF1_1 acVLRF1 baeRF_family10
Motif
Other DBs
NCBI-GeneID: 852440
NCBI-ProteinID: NP_009701
SGD: S000000347
UniProt: P12385
Structure
PDB: 

Position
II:complement(530869..532182)
Genome map
AA seq 437 aa AA seqDB search
MDNEVEKNIEIWKVKKLVQSLEKARGNGTSMISLVIPPKGQIPLYQKMLTDEYGTASNIK
SRVNRLSVLSAITSTQQKLKLYNTLPKNGLVLYCGDIITEDGKEKKVTFDIEPYKPINTS
LYLCDNKFHTEVLSELLQADDKFGFIVMDGQGTLFGSVSGNTRTVLHKFTVDLPKKHGRG
GQSALRFARLREEKRHNYVRKVAEVAVQNFITNDKVNVKGLILAGSADFKTDLAKSELFD
PRLACKVISIVDVSYGGENGFNQAIELSAEALANVKYVQEKKLLEAYFDEISQDTGKFCY
GIDDTLKALDLGAVEKLIVFENLETIRYTFKDAEDNEVIKFAEPEAKDKSFAIDKATGQE
MDVVSEEPLIEWLAANYKNFGATLEFITDKSSEGAQFVTGFGGIGAMLRYKVNFEQLVDE
SEDEYYDEDEGSDYDFI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggataacgaggttgaaaaaaatattgagatctggaaggtcaagaagttggtccaatct
ttagaaaaagctagaggtaatggtacttctatgatttccttagttattcctcctaagggt
caaattccactgtaccaaaaaatgttaacagatgaatatggtactgcctcgaatattaaa
tctagggttaatcgtctttccgttttatctgctatcacttccacccaacaaaagttgaag
ctatataatactttgcccaagaacggtttagttttatattgtggtgatatcatcactgaa
gatggtaaagaaaaaaaggtcacttttgacatcgaaccttacaaacctatcaacacatcc
ttatatttgtgtgataacaaatttcatacagaagttctttcggaattgcttcaagctgac
gacaagttcggttttatagtcatggacggtcaaggtactttgtttggttctgtgtccggt
aatacgagaactgttttacataaatttactgtcgatctgccaaaaaagcatggtagaggt
ggtcaatctgcgcttcgttttgctcgtttaagagaagaaaaaagacataattatgtgaga
aaggtcgccgaagttgctgttcaaaattttattactaatgacaaagtcaatgttaagggt
ttaattttagctggttctgctgactttaagaccgatttggctaaatctgaattattcgat
ccaagactagcatgtaaggttatttccatcgtggatgtttcttatggtggtgaaaacggt
ttcaaccaggctatcgaactttctgccgaagcgttggccaatgtcaagtatgttcaagaa
aagaaattattggaggcatattttgacgaaatttcccaggacactggtaaattctgttat
ggtatagatgatactttaaaggcattggatttaggtgcagtcgaaaaattaattgttttc
gaaaatttggaaactatcagatatacatttaaagatgccgaggataatgaggttataaaa
ttcgctgaaccagaagccaaggacaagtcgtttgctattgacaaagctaccggccaagaa
atggacgttgtctccgaagaacctttaattgaatggctagcagctaactacaaaaacttc
ggtgctaccttggaattcatcacagacaaatcttcagaaggtgcccaatttgtcacaggt
tttggtggtattggtgccatgctgcgttacaaagttaattttgaacaactagttgatgaa
tctgaggatgaatattatgacgaagatgaaggatccgactatgatttcatttaa

DBGET integrated database retrieval system