KEGG   Saccharomyces cerevisiae (budding yeast): YBR146WHelp
Entry
YBR146W           CDS       T00005                                 

Gene name
MRPS9
Definition
(RefSeq) mitochondrial 37S ribosomal protein MRPS9
  KO
K02996  small subunit ribosomal protein S9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YBR146W (MRPS9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YBR146W (MRPS9)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    YBR146W (MRPS9)
  Bacteria
    YBR146W (MRPS9)
  Archaea
    YBR146W (MRPS9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S9 DUF2277
Motif
Other DBs
NCBI-GeneID: 852443
NCBI-ProteinID: NP_009704
SGD: S000000350
UniProt: P38120
Position
II:535260..536096
Genome map
AA seq 278 aa AA seqDB search
MFSRLSLFRRAALAPAPMRMSFRTIYQKTEDELPRRIVPKLATFYSANPNHEDRINRLER
LLRKYIKLPSQNNNEAQQTKAPWISFDEYALIGGGTKLKPTQYTQLLYMLNKLHNIDPQL
TNDEITSELSQYYKKSSMLSNNIKIKTLDEFGRSIAVGKRKSSTAKVFVVRGTGEILVNG
RQLNDYFLKMKDRESIMYPLQVIESVGKYNIFATTSGGGPTGQAESIMHAIAKALVVFNP
LLKSRLHKAGVLTRDYRHVERKKPGKKKARKMPTWVKR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaggctttctttgtttcgaagggcagctctggctcctgcccctatgagaatg
tcttttaggactatttatcaaaaaaccgaggatgaattgcccagaaggatcgtcccaaag
ctagccacattttattcggcgaatcctaaccatgaagatcgtattaatcgactcgaaaga
cttctaaggaaatacataaaactgccatctcagaacaacaatgaagcacaacaaacaaaa
gctccttggatttctttcgatgagtacgctttaatcggcggtggtacgaaattaaagcct
acgcaatatactcagctactgtatatgttgaataaacttcacaacattgatcctcaactt
actaatgatgaaatcacatccgaactatcccaatattataaaaaaagttcaatgctttcc
aataatatcaaaatcaaaactttagatgagtttggaagaagtatagccgttggaaaaagg
aaaagttccactgcgaaagtattcgttgttagaggtacaggtgagatattagttaatggt
cgacaattgaatgattacttccttaagatgaaagacagagaatcaatcatgtatccactt
caagtgatcgaatcagttggaaagtacaatatttttgcgacaacgtctggaggcggacct
acgggtcaggctgaatcaatcatgcacgccattgcgaaagctttggttgtgttcaatcca
ttattaaaatccagactacataaagctggcgtcttaacaagagattacaggcacgtcgaa
agaaagaagccaggaaaaaagaaggcaagaaagatgccaacatgggtcaagagatag

DBGET integrated database retrieval system