KEGG   Saccharomyces cerevisiae (budding yeast): YBR158WHelp
Entry
YBR158W           CDS       T00005                                 

Gene name
AMN1, CST13, ICS4
Definition
(RefSeq) Amn1p
  KO
K15081  antagonist of mitotic exit network protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBR158W (AMN1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    YBR158W (AMN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 852455
NCBI-ProteinID: NP_009716
SGD: S000000362
UniProt: P38285
Position
II:556549..558198
Genome map
AA seq 549 aa AA seqDB search
MKLERVSSNGSFKRGRDIQSLESPCTRPLKKMSPSPSFTSLKMEKPFKDIVRKYGGHLHQ
SSYNPGSSKVELVRPDLSLKTDQSFLQSSVQTTPNKKSCNEYLSTPEATPLKNTATENAW
ATSRVVSASSLSIVTPTEIKNILVDEFSELKLGQPLTAQHQRSHAVFEIPEIVENIIKMI
VSLESANIPKERPCLRRNPQSYEHSLLMYKDEERAKKAWSAAQQLRDPPLVGHKEKKQGA
LFSCMMVNRLWLNVTRPFLFKSLHFKSVHNFKEFLRTSQETTQVMRPSHFILHKLHQVTQ
PDIERLSRMECQNLKWLEFYVCPRITPPLSWFDNLHKLEKLIIPGNKNIDDNFLLRLSQS
IPNLKHLVLRACDNVSDSGVVCIALNCPKLKTFNIGRHRRGNLITSVSLVALGKYTQVET
VGFAGCDVDDAGIWEFARLNGKNVERLSLNSCRLLTDYSLPILFALNSFPNLAVLEIRNL
DKITDVRHFVKYNLWKKSLDAPILIEACERITKLIDQEENRVKRINSLVALKDMTAWVNA
DDEIENNVD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagaacgcgtaagcagcaatggctccttcaaaagaggtagagatatccagtca
cttgaatctccgtgtactagaccgctgaaaaaaatgtcacctagtccatctttcacatct
cttaaaatggagaagcctttcaaagatattgtaaggaagtatggaggtcatcttcatcaa
agtagttacaatcccggctcaagcaaagtggagttagtaagaccagatttgtctttaaaa
acagatcaaagttttcttcaaagtagtgtgcaaactacgcctaataagaaaagctgcaat
gagtatctttcaactccagaggccacaccattaaaaaatacggctacagaaaatgcatgg
gcaacctctcgagttgtttctgcatccagtctttctatagtgacaccaacggaaattaaa
aacattcttgttgatgaattctctgaattgaagttagggcaacctttgactgctcaacat
cagcgaagtcatgcggtctttgaaattcctgagattgtggaaaatatcataaaaatgata
gtttctctagaatctgcaaatataccaaaggaaagaccatgcttaagaagaaatccacaa
tcttatgagcactctctgcttatgtacaaagacgaagagagagcaaaaaaagcatggtca
gcagcccagcagctacgagacccaccattagtcggacacaaggagaagaagcaaggggcc
ttatttagttgtatgatggttaacaggttatggcttaacgtaacaaggccttttcttttc
aaaagcttgcactttaagagcgtccataattttaaggagtttttacgaacttcccaggag
acgacacaagtaatgagaccgtctcattttatattgcacaaattacatcaagtaacacaa
ccagatatagaaaggctttccagaatggagtgtcaaaatttgaaatggttagaattttac
gtttgccctagaataactcccccattaagctggtttgataacctccataaacttgaaaag
cttattattccaggcaataaaaacatagatgataactttttactcagactatcacagagc
ataccaaatttaaagcacttagttttaagagcatgtgataatgtcagtgattcaggtgtt
gtttgcattgctttgaattgcccgaaattaaaaacatttaacattggcagacataggcgt
ggaaatttaattacgagtgtctcactggtcgcgctaggcaaatacacacaggtggaaact
gtggggtttgccggttgtgatgttgatgatgccggtatttgggaatttgctcgattaaat
ggcaaaaatgttgaaagattgtctttaaattcctgtcgtcttttgactgattactctcta
cccattctttttgctttaaactcatttccaaatctggctgttttagagatcagaaattta
gataaaataactgatgtgaggcatttcgtgaagtacaacttgtggaaaaaatcattggat
gcccccattctaatcgaagcatgtgaacgtattacgaaactaatcgatcaagaagaaaat
agagttaagaggattaactccttggttgccttaaaagatatgacagcttgggttaatgca
gacgacgaaatagagaataatgtggactag

DBGET integrated database retrieval system