KEGG   Saccharomyces cerevisiae (budding yeast): YBR169C
Entry
YBR169C           CDS       T00005                                 

Gene name
SSE2
Definition
(RefSeq) adenyl-nucleotide exchange factor SSE2
  KO
K09485  heat shock protein 110kDa
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YBR169C (SSE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YBR169C (SSE2)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP110
   YBR169C (SSE2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FtsA CT_C_D
Other DBs
NCBI-GeneID: 852467
NCBI-ProteinID: NP_009728
SGD: S000000373
UniProt: P32590
Position
II:complement(573915..575996)
AA seq 693 aa
MSTPFGLDLGNNNSVLAVARNRGIDVVVNEVSNRSTPSLVGFGPRNRYLGESGKTKQTSN
VKNTVENLKRIIGLKFKDPEFDIENKFFTSKLVQLKNGKVGVEVEFGGKTHVFSATQLTA
MFIDKVKHTVQEETKSSITDVCLAVPVWYSEEQRYNIADAARIAGLNPVRIVNDVTAAAV
SYGVFKNDLPGPEEKPRIIGLVDIGHSTYTCSIMAFRKGEMKVLGTAYDKHFGGRDFDRA
ITEHFADQFKDKYKIDIRKNPKAYNRILIAAEKLKKVLSANTTAPFSVESVMDDIDVSSQ
LSREELEELVEPLLKRVTYPITNALAQAKLTVNDIDFVEIIGGTTRIPVLKKSISDVFGK
PLSSTLNQDEAVAKGAAFICAIHSPTLRVRPFKFEDIDPYSVSYTWDKQVDDEDRLEVFP
ANSSYPSTKLITLHRTGDFSMKAVYTHPSKLPKGTSTTIAKWSFTGVKVPKDQDFIPVKV
KLRCDPSGLHIIENAYTTEDITVQEPVPLPEDAPEDAEPQFKEVTKTIKKDVLGMTAKTF
ALNPVELNDLIEKENELRNQDKLVAETEDRKNALEEYIYTLRAKLDDEYSDFASDAEKEK
LKNMLATTENWLYGDGDDSTKAKYIAKYEELASLGNIIRGRYLAKEEEKRQALRANQETS
KMNDIAEKLAEQRRARAASDDSDDNNDENMDLD
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgagcactccatttggcttagatttaggtaacaataactcagtactagcagttgccaga
aataggggtattgatgtcgttgtcaatgaagtttctaataggtctacaccatccttggtc
ggctttggccccagaaataggtacttaggtgaatctggtaaaactaagcaaacatcgaat
gttaaaaacactgtggaaaacttgaaaagaatcattggactaaagttcaaagaccctgaa
tttgatatcgagaataagttcttcacttcgaaattggtacagctaaaaaatggtaaagtt
ggtgtggaagtggagttcggcggtaaaacacacgtattttcagctactcaactgactgct
atgttcattgataaggtgaagcacaccgttcaagaggaaacgaagtcatcaattaccgat
gtctgcctcgcagttcctgtatggtattcggaagaacaacgttataacatagccgatgct
gccagaattgcaggattaaatcctgtaaggattgtcaacgatgtgactgcagccgccgtt
tcgtacggcgtcttcaagaatgatctgccaggtcctgaagaaaagccaagaatcattggc
ttagtggacattgggcattctacctacacctgttctattatggctttccgcaaaggcgaa
atgaaagtattaggtactgcttatgacaagcactttggtggtagagatttcgatcgcgca
atcacagaacattttgctgatcagtttaaggacaagtacaagattgacattaggaaaaat
ccgaaagcttataacagaattttaatcgctgctgaaaaattaaaaaaagtgctttctgcg
aacactactgcccccttctccgttgaatctgttatggatgatatcgacgtttcctctcaa
ttgagccgtgaagagctggaagaattagtagagcccttgttgaagcgtgtgacgtatcca
atcaccaatgcattggctcaagctaaattaactgtcaatgatattgacttcgtagaaata
attggtggtacaacccgtatcccagttttaaagaagtcaatttctgatgtttttggaaaa
cctttgtcatctactttaaatcaagacgaagctgtggccaagggggccgctttcatatgt
gccattcactctccaactttaagggtcaggccgtttaaatttgaagatattgatccgtat
tcagtgtcatacacttgggataagcaggtcgatgacgaagaccgtttggaagtattccct
gctaattcatcatatccatcaactaaactaattactttacatcgtactggagatttcagc
atgaaagcggtgtacactcatccttcgaaactgccaaaaggtacttccaccactattgca
aaatggagcttcactggggtcaaggttcctaaagatcaagattttattcctgtaaaggtc
aagttaagatgcgatccttccggcttgcatattatcgagaacgcttacacaacggaagat
attacggttcaagagccagtgcctttaccggaagacgcaccagaagatgccgagccccag
tttaaagaagttactaaaacaattaagaaagatgtgctaggtatgactgcaaaaacattc
gcgctaaacccggttgagttgaacgatctaattgaaaaagagaatgaattaagaaaccag
gataagttagttgccgaaaccgaggatcgcaaaaatgcccttgaagagtatatttatacc
cttcgtgccaaactcgatgatgaatactccgattttgcgtctgacgcagaaaaagaaaag
ctaaaaaacatgttagccactactgaaaattggttatatggtgatggtgacgattctacc
aaggcaaaatacattgctaaatatgaggagctggcatcgttggggaatattattagaggt
agatatttagcaaaggaggaagaaaaaagacaagcactcagagcgaatcaagaaacttct
aaaatgaatgatattgctgaaaaattggctgagcaaagaagggcacgcgctgcaagtgat
gatagcgatgacaacaatgatgaaaacatggaccttgattaa

DBGET integrated database retrieval system