KEGG   Saccharomyces cerevisiae (budding yeast): YBR170CHelp
Entry
YBR170C           CDS       T00005                                 

Gene name
NPL4, HRD4
Definition
(RefSeq) Npl4p
  KO
K14015  nuclear protein localization protein 4 homolog
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00400  p97-Ufd1-Npl4 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YBR170C (NPL4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NPL4 zf-NPL4 UN_NPL4
Motif
Other DBs
NCBI-GeneID: 852468
NCBI-ProteinID: NP_009729
SGD: S000000374
UniProt: P33755
Position
II:complement(576344..578086)
Genome map
AA seq 580 aa AA seqDB search
MLIRFRSKNGTHRVSCQENDLFGTVIEKLVGNLDPNADVDTFTVCEKPGQGIHAVSELAD
RTVMDLGLKHGDMLILNYSDKPANEKDGVNVEIGSVGIDSKGIRQHRYGPLRIKELAVDE
ELEKEDGLIPRQKSKLCKHGDRGMCEYCSPLPPWDKEYHEKNKIKHISFHSYLKKLNENA
NKKENGSSYISPLSEPDFRINKRCHNGHEPWPRGICSKCQPSAITLQQQEFRMVDHVEFQ
KSEIINEFIQAWRYTGMQRFGYMYGSYSKYDNTPLGIKAVVEAIYEPPQHDEQDGLTMDV
EQVKNEMLQIDRQAQEMGLSRIGLIFTDLSDAGAGDGSVFCKRHKDSFFLSSLEVIMAAR
HQTRHPNVSKYSEQGFFSSKFVTCVISGNLEGEIDISSYQVSTEAEALVTADMISGSTFP
SMAYINDTTDERYVPEIFYMKSNEYGITVKENAKPAFPVDYLLVTLTHGFPNTDTETNSK
FVSSTGFPWSNRQAMGQSQDYQELKKYLFNVASSGDFNLLHEKISNFHLLLYINSLQILS
PDEWKLLIESAVKNEWEESLLKLVSSAGWQTLVMILQESG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcagatttagatcaaaaaacggtacacacagggtttcttgtcaagaaaacgac
cttttcggaacggtcattgaaaagttggtgggtaatctggaccccaatgccgatgtcgac
acatttactgtttgtgagaagcccggtcaaggtattcatgctgtttctgaactagctgat
cgaacagtgatggatctaggactaaagcacggtgacatgctgatccttaactattcggac
aagcccgctaatgagaaagatggtgtcaatgttgaaatcggatccgtaggtattgacagc
aagggaattcgtcaacacaggtacggtccactaaggatcaaagaactcgctgtagatgag
gaactagagaaagaggacggattaattcctcgtcaaaaatcaaaactatgcaagcacggt
gatagaggtatgtgtgaatactgctcgcctttacctccttgggacaaagaatatcatgag
aagaataagatcaaacatatatcgtttcattcatatcttaaaaagctaaatgaaaatgct
aataagaaggagaacggcagctcttatatttcccctctttcagaacctgattttagaatc
aataagcgttgccataatggccatgaaccatggcctcgggggatatgttctaaatgtcaa
ccatcggcaattacattacaacagcaagaatttagaatggttgaccacgttgaatttcag
aagagtgaaataattaatgaatttattcaggcgtggaggtacacgggtatgcaaagattt
ggctatatgtacggatcttattctaagtatgataacacacctttaggtataaaggccgtc
gttgaggcgatatacgagccccctcagcatgatgagcaagacggtttaaccatggacgta
gaacaggtcaagaatgaaatgctacagattgatagacaggctcaagaaatggggctttcg
cgaattggcctaatatttacagatttatctgacgcgggagctggggatgggtctgttttt
tgcaaaagacataaggattcgttttttctttcatcattagaagttattatggctgctagg
catcaaacaaggcatcctaatgtaagcaagtatagcgaacaaggttttttttcttccaag
tttgtaacttgcgttatatcaggtaatttggaaggtgaaattgatatttcgagctaccaa
gtatccacagaagctgaagcattggttactgcagatatgataagtgggtccacatttcct
tcaatggcatatattaatgacactacagatgaaagatatgtacctgagatattttacatg
aagtcgaatgaatatggtataacagtgaaggaaaatgcgaagcctgcatttccggtagac
tatcttttagtgacgctgactcatgggttcccgaataccgatacggaaaccaactcgaaa
ttcgttagttccaccggatttccatggagcaatcgacaagctatggggcaatctcaagat
tatcaagaattaaaaaagtatttattcaatgtggcttcaagtggagatttcaatcttttg
catgaaaaaatctcgaactttcatttactattatacataaattctctgcagatactctct
ccagacgaatggaagttactaatagaatctgctgtgaaaaatgaatgggaagaatctcta
ctaaaacttgtctcatcggctggttggcaaacgttagtcatgatccttcaggaaagcggc
tag

DBGET integrated database retrieval system