KEGG   Saccharomyces cerevisiae (budding yeast): YBR189WHelp
Entry
YBR189W           CDS       T00005                                 

Gene name
RPS9B, RPS13A, SUP46
Definition
(RefSeq) ribosomal 40S subunit protein S9B
  KO
K02997  small subunit ribosomal protein S9e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YBR189W (RPS9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YBR189W (RPS9B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YBR189W (RPS9B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4
Motif
Other DBs
NCBI-GeneID: 852487
NCBI-ProteinID: NP_009748
SGD: S000000393
UniProt: P05755
Position
II:join(604508..604514,604928..605508)
Genome map
AA seq 195 aa AA seqDB search
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAAEEAEDEE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagctccaagaacttactctaagacttactctacaccaaagagaccttacgaa
tcttctcgtttggacgcagaattgaagttggccggtgaattcggtttgaagaacaagaga
gaaatttacagaatttctttccaattgtctaaaattcgtcgtgctgccagagacttgtta
actagagacgaaaaggacccaaagagattgttcgaaggtaatgccttgatcagaagattg
gttagagttggtgtcttgtccgaagacaagaagaagttggattatgttttggctttgaag
gttgaagatttcttggaaagaagattgcaaactcaagtctacaagttgggtttggccaag
tctgtccaccacgccagagttttaatcactcaaagacacattgctgttggtaagcaaatc
gtcaacatcccatctttcatggtcagattggactctgaaaagcacattgacttcgctcca
acttctccattcggtggtgctagaccaggtagagttgctagaagaaacgctgctagaaag
gctgaagcttccggtgaagctgctgaagaagccgaagacgaagaataa

DBGET integrated database retrieval system