KEGG   Saccharomyces cerevisiae (budding yeast): YBR191WHelp
Entry
YBR191W           CDS       T00005                                 

Gene name
RPL21A, URP1
Definition
(RefSeq) ribosomal 60S subunit protein L21A
  KO
K02889  large subunit ribosomal protein L21e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YBR191W (RPL21A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YBR191W (RPL21A)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    YBR191W (RPL21A)
  Archaea
    YBR191W (RPL21A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L21e SIMPL LRS4
Motif
Other DBs
NCBI-GeneID: 852489
NCBI-ProteinID: NP_009750
SGD: S000000395
UniProt: Q02753
Structure
PDB: 

Position
II:join(606270..606280,606669..607140)
Genome map
AA seq 160 aa AA seqDB search
MGKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGK
TGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKCRQEFLERVKANAAKRAEAK
AQGVAVQLKRQPAQPRESRIVSTEGNVPQTLAPVPYETFI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatcacacggttacagatctcgtactcgttacatgttccaacgtgacttcaga
aagcatggtgccgtccatctttctacttacttgaaggtctacaaggttggtgacattgtc
gacatcaaagccaatggttctatccaaaagggtatgccacacaagttttaccaaggtaag
accggtgttgtctacaacgttactaagtcttctgttggtgttatcatcaacaagatggtc
ggtaacagatatctagaaaaaagattaaacttaagagttgaacacatcaagcactccaag
tgtagacaagaatttttggaaagagttaaggccaatgctgctaagcgtgctgaagctaag
gctcaaggtgttgctgttcaattgaagagacaaccagctcaaccaagagaatcccgtatc
gtttctactgaaggtaacgttcctcaaactttggccccagttccatacgaaactttcatc
taa

DBGET integrated database retrieval system