KEGG   Saccharomyces cerevisiae (budding yeast): YBR192W
Entry
YBR192W           CDS       T00005                                 

Gene name
RIM2, PYT1
Definition
(RefSeq) Rim2p
  KO
K15116  solute carrier family 25, member 33/36
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YBR192W (RIM2)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YBR192W (RIM2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 852491
NCBI-ProteinID: NP_009751
SGD: S000000396
UniProt: P38127
Position
II:607652..608785
AA seq 377 aa
MPKKSIEEWEEDAIESVPYLASDEKGSNYKEATQIPLNLKQSEIENHPTVKPWVHFVAGG
IGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETL
GIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLM
AAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLS
ASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKF
VASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVP
NSIIMFGTWEIVIRLLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgcctaaaaaatccattgaagaatgggaagaggatgccattgaatcagttccatattta
gcaagtgatgaaaagggctctaattataaggaagctacacaaattccactaaatttgaag
caatctgaaattgaaaatcatccaacagtaaaaccatgggttcattttgttgctgggggt
attggaggaatggcgggtgcagttgttacgtgtccctttgatttggtgaagacccgatta
caaagtgatatatttttgaaagcatacaaatcacaagctgttaatatcagtaaaggatct
actcgtccaaagagtattaattatgtcattcaagcaggaacccatttcaaggaaacactg
ggaatcataggcaatgtgtacaaacaagagggttttagaagcttgtttaagggtttgggc
cccaatttagtcggggttattccagcaagaagtattaatttttttacctatggaactact
aaagatatgtatgctaaagcgttcaataatggccaagaaacacctatgattcatctgatg
gctgctgcaaccgcaggttgggcaacggcgacggcaaccaatcctatttggttgattaaa
acaagagtacagcttgataaagctgggaaaacatcggtccgacagtacaagaactcttgg
gattgcttaaaaagtgttataagaaatgagggtttcactggcttgtacaaagggttgagt
gcctcttatttgggttctgttgaaggtatacttcaatggctattatatgaacaaatgaag
aggttaataaaggaaaggtctattgagaaatttggatatcaagccgaaggtacaaaaagc
acatcagagaaagtcaaggagtggtgtcaaagatcaggaagcgctggtcttgcaaaattt
gtggctagtatagcaacatatccgcacgaagttgtcaggacgagattgagacaaacgccc
aaggaaaatggtaaacgaaagtatacaggtttagtacaaagtttcaaagttataattaaa
gaagagggactcttttcaatgtatagtgggttgaccccgcatttgatgagaacagttccg
aacagtataattatgtttggtacatgggaaattgttataaggctactatcgtag

DBGET integrated database retrieval system