KEGG   Saccharomyces cerevisiae (budding yeast): YBR200W
Entry
YBR200W           CDS       T00005                                 

Gene name
BEM1, SRO1
Definition
(RefSeq) phosphatidylinositol-3-phosphate-binding protein BEM1
  KO
K11237  bud emergence protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YBR200W (BEM1)
SSDB
Motif
Pfam: SH3_1 SH3_9 PX SH3_2 PB1
Other DBs
NCBI-GeneID: 852499
NCBI-ProteinID: NP_009759
SGD: S000000404
UniProt: P29366
Structure
PDB: 

Position
II:620872..622527
AA seq 551 aa
MLKNFKLSKRDSNGSKGRITSADISTPSHDNGSVIKHIKTVPVRYLSSSSTPVKSQRDSS
PKNRHNSKDITSPEKVIKAKYSYQAQTSKELSFMEGEFFYVSGDEKDWYKASNPSTGKEG
VVPKTYFEVFDRTKPSSVNGSNSSSRKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGE
NLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQ
EWKSNIARYKASNISLGSVEQQQQQSITKPQNKSAKLVDGELLVKASVESFGLEDEKYWF
LVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPY
VTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNNGFDREFERDENQNNIKTL
QENDTATFATASQTSNFASTNQDNTLTGEDLKLNKKLSDLSLSGSKQAPAQSTSGLKTTK
IKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNII
QAKLKISVHDI
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgctgaaaaacttcaaactctcaaaaagagatagtaatgggtcgaagggcagaattaca
tccgcagatatttccacaccttctcatgataatgggagtgttataaagcatattaagaca
gtaccagtgaggtacctttcttcatcttccaccccagtgaaaagccaacgggactcttca
ccaaaaaacagacataattctaaagatattacttctccagagaaagttataaaagccaaa
tacagttatcaggcacaaacttcaaaggaactatctttcatggaaggtgaatttttttat
gtatctggagatgagaaggattggtataaagcttcaaatccttctactggaaaagagggt
gttgtccccaaaacctattttgaagtgtttgatagaactaaaccttcctctgtgaatgga
tccaatagttcaagtcggaaggttacaaatgattcattaaacatgggatcgttatacgcc
attgttttatatgactttaaggcagaaaaagctgatgagttgacaacttatgtgggagag
aatttgtttatttgcgcccaccataactgtgaatggttcattgctaagccaattggtcga
cttggagggcccggccttgttcctgttgggtttgttagcatcatagatattgccacgggg
tacgcaacaggtaacgacgtaatagaagacatcaagtcagttaacctaccaactgttcaa
gaatggaaaagcaacattgcaagatacaaagctagtaatattagccttggttctgtggag
cagcagcagcagcaatccattacaaaacctcagaacaaaagcgcaaagctggttgacggt
gaattattagtgaaagcatccgttgaatcctttgggttagaagatgagaagtattggttt
ttggtttgctgtgaattatctaacggtaagacgaggcaactgaaaagatactatcaagat
ttctacgatctgcaggttcaacttttggatgcgttcccagcagaggccggtaagttgagg
gatgcaggtggacaatggtccaaacgtataatgccctatatccctggacccgttccatac
gttaccaatagcataacaaaaaaaagaaaggaggacttgaatatatatgtggcagaccta
gtgaatcttcccgattatatatctcgctcagaaatggtgcattccttattcgttgttttg
aataatggtttcgacagagaatttgaaagagacgaaaatcaaaacaatattaaaacatta
caagaaaacgatacagcaacctttgcaacagcatctcaaacttctaattttgcctcaact
aaccaagacaacactttaactggcgaagacttgaagttaaacaagaaactctcagattta
tctttatcgggctccaagcaggctccagcccaatcaacttctggattgaaaactactaaa
attaaattttattacaaagacgatatttttgctttaatgctgaagggtgacacaacctat
aaagaacttcgtagtaaaatcgctccaaggattgatacagataattttaaattacaaacc
aaattatttgatggtagcggggaggaaattaagactgattcacaagtcagtaacataatc
caagccaaactgaaaatttccgttcacgatatttga

DBGET integrated database retrieval system