KEGG   Saccharomyces cerevisiae (budding yeast): YBR213WHelp
Entry
YBR213W           CDS       T00005                                 

Gene name
MET8
Definition
(RefSeq) bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase MET8
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00860  Porphyrin and chlorophyll metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YBR213W (MET8)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     YBR213W (MET8)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     YBR213W (MET8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M HU-CCDC81_bac_1 ThiF Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 852514
NCBI-ProteinID: NP_009772
SGD: S000000417
UniProt: P15807
Structure
PDB: 

Position
II:650368..651192
Genome map
AA seq 274 aa AA seqDB search
MVKSLQLAHQLKDKKILLIGGGEVGLTRLYKLIPTGCKLTLVSPDLHKSIIPKFGKFIQN
EDQPDYREDAKRFINPNWDPTKNEIYEYIRSDFKDEYLDLEDENDAWYIIMTCIPDHPES
ARIYHLCKERFGKQQLVNVADKPDLCDFYFGANLEIGDRLQILISTNGLSPRFGALVRDE
IRNLFTQMGDLALEDAVVKLGELRRGIRLLAPDDKDVKYRMDWARRCTDLFGIQHCHNID
VKRLLDLFKVMFQEQNCSLQFPPRERLLSEYCSS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaatcgctacagctagcccatcaattaaaagacaagaaaatactactaatcgga
ggcggagaagtcggcttgacaaggttatataagctgatacctacaggttgcaagctgact
ttagtatctcctgacctacacaaatccattattccgaagtttggaaaattcatccagaac
gaggatcagcccgactacagagaagacgctaaacgctttatcaatccgaactgggacccc
acgaagaatgaaatttacgagtacatccgcagtgacttcaaagacgaatacctcgaccta
gaagacgagaacgacgcgtggtacataataatgacctgtatacccgaccaccctgaaagc
gcaagaatatatcacctttgtaaggaaagattcggtaagcagcagctggtcaatgtggcg
gacaaacctgatctctgtgacttttatttcggcgccaacctggagataggagaccgtcta
cagattctgatctctaccaacggcctttctccgcgctttggcgctctagtaagagatgag
atccgtaacttattcacacaaatgggggatctggcgctggaggacgctgtcgtcaaacta
ggtgagctgagaagaggaattaggctgctggcaccagacgacaaggatgtcaagtaccgc
atggattgggccagacgctgcacagacctcttcggcattcagcactgccacaacatcgac
gtaaaacgtctgctggatcttttcaaggtcatgtttcaagaacagaactgttccttgcag
ttccctcccagagaacggttgcttagcgagtactgctcgtcttga

DBGET integrated database retrieval system