KEGG   Saccharomyces cerevisiae (budding yeast): YBR214WHelp
Entry
YBR214W           CDS       T00005                                 

Gene name
SDS24
Definition
(RefSeq) Sds24p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 852515
NCBI-ProteinID: NP_009773
SGD: S000000418
UniProt: P38314
Position
II:651415..652998
Genome map
AA seq 527 aa AA seqDB search
MASTSNTFPPSQSNSSNNLPTSRHASIVEMLSTPPLLPHVQVNDTDDKEQPEESTPPTAT
AAAPGPGCAATPAPLRDEKPQFKLSAVPMTQTPSQCLSCVHAQKWQHIPLSQLIEQNKLI
FVPGSISVEEAFNTLIKYHLNSIPVESFPGDMNCFTFDYNDLNSYLLLVLNKITVSNKQL
TADCQNGKPVPVGEMVKLTPKNPFYKLPENESLSTVMGILGSGVHRVAITNEEMTKVKGI
LSQRRLIKYLWDNARSFTSLEPLLNSSLQDLHIGVLNIQSKPTSRQSRVISIQGEEPLIM
GLYKMHVERISSIAVIDKQGNLLGNISVTDVKHVTRTSQYPLLHKTCRHFISVILNSRGL
ETGKDSFPIFHVYPSSSLARTLAKLVATKSHRLWIVQPPESSTSASSTNLTAANTAANAV
SATAQSSANGATPMSKSSSSTSLNSHSPLMTAMEDPPSPRSSAIAIPPPSPASSTNTPNL
FEKEYRTGKLIGVVSLTDIINLLARKQTGNKEVDPQSARRQRGSIAM
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcttctacttcgaacacgttccctccaagccaaagcaattcttccaacaaccttcca
acttctagacatgcatccattgtggagatgctgtctactccgccattgctgccccacgtt
caagtgaacgatacagacgacaaggaacaaccagaagagtccacgccgccaacagcaaca
gcggcagcgcctggtccaggttgtgctgctacacccgcccccttgcgcgatgaaaagcct
caattcaaactatcagctgttcctatgacccagacgccatcgcagtgtctgtcatgtgtg
cacgcccaaaaatggcaacacataccgttgtcgcaattgatcgaacagaataagcttatt
tttgttccaggttccatatcggtagaggaggcattcaacactttgatcaagtatcatcta
aactctattcccgtggaatctttccccggcgacatgaactgttttactttcgactacaat
gaccttaattcgtaccttttgctggttttgaataaaatcaccgtcagcaacaaacagctt
actgcagattgccagaatggaaaacccgtaccagtgggcgaaatggtgaaactaactcct
aagaatccgttctataagctgccggagaatgagagtttgtccacggtgatggggattctc
ggttcgggtgtccatcgtgtagcgataacaaacgaagagatgaccaaagttaaaggtatt
ttgtcccaacgtcgtttgataaagtatctttgggacaacgctagatcttttacaagctta
gaacctctattaaactcctcattacaagatttgcacatcggtgttctcaatattcaatct
aagccaacttcaagacaatcccgtgtcatctctattcaaggcgaggagcccttaatcatg
ggcctttataaaatgcatgtggaaagaatttcttccattgcagtcatcgacaaacaaggt
aatttgctaggtaacatatcggtaacggacgtaaaacatgtcacaagaacctcccaatac
cccttactacataagacatgtcgccatttcatttctgtcattttaaactccagaggatta
gaaacgggtaaagattctttccccatttttcacgtataccccagtagttcactagcaagg
actcttgccaagttagttgctacaaagtctcatagactatggatcgtacaaccgccggag
tcgtcaacctcggcgtcatccacaaatttaacagctgctaatactgcagccaatgcagtt
tctgccaccgctcaatcgtctgctaatggtgcgactccaatgtcaaagtcatcctcttca
acatccctcaactcccactctccgttgatgacagcaatggaagacccaccatccccacgt
tcttcggccatcgcgatcccaccaccaagtcccgcttcctcaacaaacacaccaaaccta
ttcgaaaaggaatatagaacgggtaagttgatcggtgtggtctcattgacagacatcatc
aacttattagcaaggaaacaaacagggaataaagaagtggatccgcaatccgcaagaaga
cagagaggcagtatcgccatgtga

DBGET integrated database retrieval system