KEGG   Saccharomyces cerevisiae (budding yeast): YBR216CHelp
Entry
YBR216C           CDS       T00005                                 

Gene name
YBP1
Definition
(RefSeq) Ybp1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinetochor_Ybp2
Motif
Other DBs
NCBI-GeneID: 852517
NCBI-ProteinID: NP_009775
SGD: S000000420
UniProt: P38315
Position
II:complement(655576..657600)
Genome map
AA seq 674 aa AA seqDB search
MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP
STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE
LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKL
KSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNY
IPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYC
ALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN
DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA
IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV
LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL
SRRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQ
DSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYKEIV
DKNESLNDYFTGIK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaattgatgacatactttttgaggttactgatgcgttcaaaactcagaaggag
gatcttcttgagttggtaacattgattgatatatatggcgagcaagttaaccaagagggg
agctatgaagaaaagacgagattcattgaaactttgaatacattgttagaggataatccg
agtactactggtgaaatcggttgggatctgcctaagggattattgaagttcttgtcaaag
gataatgtcgatgtaaatggaagactaggtacgaatatgattgtccaaggtgtaatgaag
tgtttctatgccatctcaatccaaggcgagcccaaaaaatgtttaattactgggttggag
ttgctttcatccctttgttcaaaagatttttccaagagtgatcaacagaataaggaagac
tttgttgataaaaaggccaatacgttacctcctgaaggagtaatcgaaaattcctctaat
cgaaaagattttccatcctacggtgaaagcaagagttcaaatgaatttttcttgaagttg
aaatcctacattttatttgaattcataggggcgagtctgaaaaggatttctactctgttt
ccttcgaaatatctgggagctgctgtgtcaacaattgagaaatttgtgtatagtcatgcg
gacacttttgaagatgcccttttccttcttcgtagggtgtacacattctgcaggaactat
attccccctgatccaccaaaagatatacaattgaacgaagattttactcgagagatgttt
gataaagttgtggaggaagaaagtgaattacaggttagactattgcgtaggctttgtact
tttggtatttcgacacccataaaaactgtcaccaccaatgccgacgtgaaatactattgt
gcactaaatcaacagaagtttgaattatctgcatattacaccgaatatcttgagctattt
tgcaggtattaccaaatggcgttctcgcttgatgttgatatagagggagaatttcagaat
gtgataaaagaatgtaggattatttataagtctgtaccccaggagatttccgctgttaat
gatgaagcaaagttggttttggaaagaatggtatataaattggcttatacattcgaagta
caaaaggccgctaaagaaaaaaatgttggtttggactataatggtgtaatattattttct
ggtatccactatttggaaaccaatcaacatttagtaaaggaaatgaatataacggatgcc
atttatctctacttgagatttacaactccatcattatattctaaagtttactataatgta
gcagttgaatcagttagtcgctactggctatggtatgctattacaaccgagcccttggag
gatgtaaaaaaagaattgaagaatctttcagtgtttgttacaaaaacattattgcatgtt
ctacttcaaaagaactgtattcaggtcaatcagcagttaagaatgataactttcactctt
ctcaccagattactatgtttaatacctgaaaaagttgcatttgagtttatcttagatgtg
cttaagacatctccccttccattggctaagacgtccgtattatgtgtttttaaagacctt
tcaaggcgacgcatctccaccaaggataacgattctgagacggatttgattgtcgaaaaa
ttatccaaactgaaggtcaatgatagtaacaaagctcagcaaagtaacatcagacattat
atccaactagattcttccaaaatgaaagctgttcatgactgttgtctgcagactatccaa
gattcatttacggcagatgccaagaagagtgatatattattactgctaacttacttgaat
attttcattgtgctaaaaaaaacatgggatgaagatctactgaagattgtttgttcgaag
attgattctaatttgaagtcagtcgaacctgataaacttccgaagtataaggaaattgtg
gataaaaacgaatctctaaatgactattttactggtataaaatga

DBGET integrated database retrieval system