KEGG   Saccharomyces cerevisiae (budding yeast): YBR221CHelp
Entry
YBR221C           CDS       T00005                                 

Gene name
PDB1
Definition
(RefSeq) pyruvate dehydrogenase (acetyl-transferring) subunit E1 beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00020  Citrate cycle (TCA cycle)
sce00620  Pyruvate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBR221C (PDB1)
   00020 Citrate cycle (TCA cycle)
    YBR221C (PDB1)
   00620 Pyruvate metabolism
    YBR221C (PDB1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     YBR221C (PDB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C Peptidase_M78
Motif
Other DBs
NCBI-GeneID: 852522
NCBI-ProteinID: NP_009780
SGD: S000000425
UniProt: P32473
Position
II:complement(665153..666253)
Genome map
AA seq 366 aa AA seqDB search
MFSRLPTSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVF
LIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFN
FSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKV
LVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGT
DISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVES
TFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK
EVLSIE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttttccagactgccaacatcattggccagaaatgttgcacgtcgtgccccaacttct
tttgtaagaccctctgcagcagcagcagcattgagattctcatcaacaaagacgatgacc
gtcagagaggccttgaatagtgccatggcggaagaattggaccgtgatgatgatgtcttc
cttattggtgaagaagttgcacaatataacggggcttataaggtgtcaaagggtttattg
gacaggttcggtgaacgtcgtgtggttgacacacctattaccgaatacgggttcacaggt
ttggccgttggtgccgctttgaagggtttgaagccaattgtagagtttatgtcgttcaat
ttctctatgcaagctatcgatcatgttgtcaattccgctgcaaagactcactacatgtct
ggtggtactcaaaaatgtcaaatggtcttcagaggtcctaatggtgctgcagtgggtgtt
ggtgctcaacattcacaggacttttctccttggtacggttccattccagggttaaaggtc
cttgtcccttattctgctgaagatgctaggggtttgttaaaggccgccatcagagatcca
aaccctgttgtatttttagagaacgaattgttgtacggtgaatcttttgaaatctcagaa
gaagctttatcccctgagttcaccttgccatacaaggctaagatcgaaagagaaggtacc
gatatttccattgttacgtacacaagaaacgttcagttttctttggaagccgctgaaatt
ctacaaaagaaatatggtgtctctgcagaagttatcaacttgcgttctattagaccttta
gatactgaagctatcatcaaaactgtcaagaagacaaaccacttgattactgttgaatcc
actttcccatcatttggtgttggtgctgaaattgtcgcccaagttatggagtctgaagcc
tttgattacttggatgctccaatccaaagagttactggtgccgatgttccaacaccttac
gctaaagaattagaagatttcgctttccctgatactccaaccatcgttaaagctgtcaaa
gaagtcttgtcaattgaataa

DBGET integrated database retrieval system