KEGG   Saccharomyces cerevisiae (budding yeast): YBR222CHelp
Entry
YBR222C           CDS       T00005                                 

Gene name
PCS60, FAT2
Definition
(RefSeq) Pcs60p
  KO
K22133  oxalate---CoA ligase [EC:6.2.1.8]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00630  Glyoxylate and dicarboxylate metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YBR222C (PCS60)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.8  oxalate---CoA ligase
     YBR222C (PCS60)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 852523
NCBI-ProteinID: NP_009781
SGD: S000000426
UniProt: P38137
Position
II:complement(666720..668351)
Genome map
AA seq 543 aa AA seqDB search
MTSAATVTASFNDTFSVSDNVAVIVPETDTQVTYRDLSHMVGHFQTMFTNPNSPLYGAVF
RQDTVAISMRNGLEFIVAFLGATMDAKIGAPLNPNYKEKEFNFYLNDLKSKAICVPKGTT
KLQSSEILKSASTFGCFIVELAFDATRFRVEYDIYSPEDNYKRVIYRSLNNAKFVNTNPV
KFPGFARSSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTPLDRSYVVMPLF
HVHGLIGVLLSTFRTQGSVVVPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNMPKPNP
FPHIRFIRSCSSALAPATFHKLEKEFNAPVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQ
PQGVTVVILDDNDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGY
FDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYGQVVQAAI
VLKKGEKMTYEELVNFLKKHLASFKIPTKVYFVDKLPKTATGKIQRRVIAETFAKSSRNK
SKL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgccgctactgttactgcttcgttcaacgatacttttagcgtatccgataat
gtcgccgttattgttcctgaaacggacactcaggtgacctacagggatctatcccacatg
gtgggtcacttccagaccatgttcacaaatcctaattctccattgtacggagctgttttc
agacaagatacagtggcgatatccatgcgtaatgggctggaatttatcgtcgctttcctc
ggtgctactatggacgctaaaattggcgcgcccttgaatcccaattataaggaaaaggag
ttcaatttttatttgaatgacctgaaatctaaggcgatttgcgtcccaaagggtaccaca
aagttacagagttctgaaattctaaaatctgcctccacgtttggatgttttatcgtagag
ctggccttcgatgcgaccaggtttagggtagagtatgatatatactctccagaggacaac
tacaaaagggttatttaccggtctttgaacaacgccaaatttgtcaacacaaatcccgtt
aaattccctgggtttgcccgttccagtgacgttgccctgattttgcataccagtggtacc
acctccactccaaaaacggtgcctttgttacatttgaacattgtgagaagcacgttgaac
attgctaacacttacaagctaacgcccttggacagatcttatgtcgtgatgcctcttttc
cacgtccatgggttaattggtgttttactttccacttttagaactcagggttctgttgtg
gttcccgatggattccatccaaagttattctgggaccaatttgttaagtacaactgtaat
tggttcagttgcgttcccacaataagcatgattatgctgaacatgcccaaaccaaaccct
ttcccacacattagattcatcagatcgtgttcttctgctttggctccagcaacgttccat
aagctggagaaggaattcaatgcacctgtcttggaggcctatgcgatgaccgaagcatca
catcaaatgacctcaaacaatctgcctccaggaaagagaaagcctggtactgtgggccag
ccacaaggagtcaccgtcgtcattctagatgacaatgacaatgtcttgcccccgggcaaa
gtcggcgaagtttccatcagaggcgaaaacgtcactttggggtatgctaataatccaaaa
gctaacaaggagaacttcaccaagagagagaactatttcagaaccggtgaccaaggttat
ttcgaccctgaggggtttttggtccttacaggcagaatcaaagagcttatcaacaggggt
ggtgaaaagatttcacccattgagctcgacggcattatgctatcgcatccaaagatcgat
gaagccgttgcatttggtgttcccgacgatatgtacggccaagtagttcaagccgccatt
gttttgaagaagggagaaaaaatgacctacgaagaactggtgaacttcttaaagaagcac
ctagcctctttcaaaattccaaccaaggtgtactttgttgataagctaccaaaaaccgct
acaggtaaaatccagagaagagttatcgcagaaacttttgctaagagcagcagaaataag
agtaagttgtag

DBGET integrated database retrieval system