KEGG   Saccharomyces cerevisiae (budding yeast): YBR227CHelp
Entry
YBR227C           CDS       T00005                                 

Gene name
MCX1
Definition
(RefSeq) Mcx1p
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YBR227C (MCX1)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP100
   YBR227C (MCX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA AAA_5 ClpB_D2-small AAA_22 Mg_chelatase AAA_16 Sigma54_activ_2 Sigma54_activat RuvB_N AAA_14 MCM IstB_IS21 AAA_24 DEAD T2SSE AAA_33 NACHT AAA_18 AAA_7 PhoH RNA_helicase AAA_29 ABC_tran FtsK_SpoIIIE CbiA
Motif
Other DBs
NCBI-GeneID: 852528
NCBI-ProteinID: NP_009786
SGD: S000000431
UniProt: P38323
Position
II:complement(673572..675134)
Genome map
AA seq 520 aa AA seqDB search
MLKSASQNFFRAYSSRIGRYAATASGKLAQSRLSNIPTPKALKKFLDEYIVGQEIGKKVL
SVAVYNHYLRINDKQKKGELQRQRELMEREKIADDRDEPIFSGNSESKAGWRNLQRQFNL
AGREVDEDLELSKSNVLVVGPSGSGKTLLATTLAKILNVPIAITDCTQLTQAGYIGEDVE
VCIERLLVNAEFDVARAEKGIIVLDEIDKLAKPAASIGTKDVSGEGVQQSLLKIIEGHKV
EITVKRPVKHDIDGQKNQTTTKKDEVFVVDTSNILFMIMGAFVGLDKHIVKRIEDMKKIQ
KAGESVESSNSKEVEKERAKKFRFSNTLEQVELDNGKKVCALDLTTPTDLVSFGLIPELI
GRVPIITALQPLQRDDLFHILKEPKNALLDQYEYIFKQFGVRLCVTQKALKKVAQFALKE
GTGARGLRGIMERLLLNVNYDCPGSNIAYVLIDEATVDSLQETEHSLASQVDVKYYSGDE
KDSLIRDVSEEDKKLGVMLEKELGHSANIHTPTIPKRSLT
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatctgcaagccaaaacttttttagagcttattctagtagaattggtcgatat
gctgctacagcatcagggaaactggcacagtctcgtttatcgaatatacccactccaaaa
gcattgaagaaattcctcgatgagtacattgttggtcaagagattggtaagaaggtttta
agcgtggcagtttataatcactatttaagaatcaatgacaagcaaaagaaaggggaatta
caaaggcagagagaattgatggaacgagagaaaatcgcggatgatagggatgaaccaatt
ttcagtggaaacagcgaatcaaaggctggttggaggaatcttcaaagacagtttaattta
gcaggtagagaggttgacgaagatttagagttaagcaaaagtaatgtccttgtcgttggt
ccctcaggttctggtaagactttgttggcaacaacattggcgaaaatattaaacgttcca
attgcaattacagattgtacacaattgactcaagcaggttacataggtgaagatgttgaa
gtatgcattgaaagattgctcgtaaatgctgaatttgatgttgcgagagcagaaaaaggt
attattgttcttgatgagattgataaactagccaagcctgccgcaagcattggcactaaa
gacgtgtccggagaaggggttcaacagtcattattgaaaatcattgagggccataaagtg
gaaattaccgttaaaaggcctgttaagcatgatattgacggacaaaaaaatcaaactaca
acaaagaaggacgaagtatttgttgtagacacttcaaatattcttttcatgattatggga
gcttttgttggtttagataagcatattgttaaaaggatagaagatatgaagaaaatacag
aaggcaggagagtctgttgaatcatcgaatagtaaagaagttgaaaaagaaagagcgaag
aagttcagatttagcaatacgcttgagcaggttgaattagataacggaaaaaaagtgtgt
gctttagacttgaccacccccacagatttagttagctttggtctaattcctgaattaatt
ggcagagtcccaattataactgctctgcagcctctacaaagagacgatttatttcatata
ttaaaagaacctaaaaatgccttattggatcaatatgaatatatttttaagcaatttggg
gtaagattgtgtgttacacaaaaggcgctaaagaaagttgctcaatttgctctcaaggaa
ggaactggcgccagagggttgagagggataatggaaagacttctgctaaacgttaattat
gattgcccgggttctaacatagcatacgttttaatcgacgaagctactgtcgactcgtta
caggaaacagagcactctttggcttcccaagtggacgtaaaatactattctggtgatgaa
aaggacagtttaattcgtgacgtttctgaagaagataaaaaattaggagttatgctagaa
aaagagttgggtcattctgctaacattcataccccaacaattcccaagagaagcttaaca
taa

DBGET integrated database retrieval system