KEGG   Saccharomyces cerevisiae (budding yeast): YBR229CHelp
Entry
YBR229C           CDS       T00005                                 

Gene name
ROT2, GLS2
Definition
(RefSeq) glucan 1,3-alpha-glucosidase ROT2
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce01100  Metabolic pathways
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00073  N-glycan precursor trimming
sce_M00074  N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YBR229C (ROT2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YBR229C (ROT2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     YBR229C (ROT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 852530
NCBI-ProteinID: NP_009788
SGD: S000000433
UniProt: P38138
Position
II:complement(676357..679221)
Genome map
AA seq 954 aa AA seqDB search
MVLLKWLVCQLVFFTAFSHAFTDYLLKKCAQSGFCHRNRVYAENIAKSHHCYYKVDAESI
AHDPLENVLHATIIKTIPRLEGDDIAVQFPFSLSFLQDHSVRFTINEKERMPTNSSGLLI
SSQRFNETWKYAFDKKFQEEANRTSIPQFHFLKQKQTVNSFWSKISSFLSLSNSTADTFH
LRNGDVSVEIFAEPFQLKVYWQNALKLIVNEQNFLNIEHHRTKQENFAHVLPEETTFNMF
KDNFLYSKHDSMPLGPESVALDFSFMGSTNVYGIPEHATSLRLMDTSGGKEPYRLFNVDV
FEYNIGTSQPMYGSIPFMFSSSSTSIFWVNAADTWVDIKYDTSKNKTMTHWISENGVIDV
VMSLGPDIPTIIDKFTDLTGRPFLPPISSIGYHQCRWNYNDEMDVLTVDSQMDAHMIPYD
FIWLDLEYTNDKKYFTWKQHSFPNPKRLLSKLKKLGRNLVVLIDPHLKKDYEISDRVINE
NVAVKDHNGNDYVGHCWPGNSIWIDTISKYGQKIWKSFFERFMDLPADLTNLFIWNDMNE
PSIFDGPETTAPKDLIHDNYIEERSVHNIYGLSVHEATYDAIKSIYSPSDKRPFLLTRAF
FAGSQRTAATWTGDNVANWDYLKISIPMVLSNNIAGMPFIGADIAGFAEDPTPELIARWY
QAGLWYPFFRAHAHIDTKRREPYLFNEPLKSIVRDIIQLRYFLLPTLYTMFHKSSVTGFP
IMNPMFIEHPEFAELYHIDNQFYWSNSGLLVKPVTEPGQSETEMVFPPGIFYEFASLHSF
INNGTDLIEKNISAPLDKIPLFIEGGHIITMKDKYRRSSMLMKNDPYVIVIAPDTEGRAV
GDLYVDDGETFGYQRGEYVETQFIFENNTLKNVRSHIPENLTGIHHNTLRNTNIEKIIIA
KNNLQHNITLKDSIKVKKNGEESSLPTRSSYENDNKITILNLSLDITEDWEVIF
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggtccttttgaaatggctcgtatgccaattggtcttctttaccgctttttcgcatgcg
tttaccgactatctattaaagaagtgtgcgcaatctgggttttgccatagaaacagggtt
tatgcagaaaatattgccaaatctcatcactgctattacaaagtggacgccgagtctatt
gcacacgatcctttagagaatgtgcttcatgctaccataattaaaactataccaagattg
gagggcgatgatatagccgttcagttcccattctctctctcttttttacaggatcactca
gtaaggttcactataaatgagaaagagagaatgccaaccaacagcagcggtttgttgatc
tcttcacaacggttcaatgagacctggaagtacgcattcgacaagaaatttcaagaggag
gcgaacaggaccagtattccacaattccacttccttaagcaaaaacaaactgtgaactca
ttctggtcgaaaatatcttcatttttgtcactttcaaactccactgcagacacatttcat
cttcgaaacggtgatgtatccgtagaaatctttgctgaaccttttcaattgaaagtttac
tggcaaaatgcgctgaaacttattgtaaacgagcaaaatttcctgaacattgaacatcat
agaactaagcaggaaaacttcgcacacgtgctgccagaagaaacaactttcaacatgttt
aaggacaatttcttgtattcaaagcatgactctatgcctttggggcctgaatcggttgcg
ctagatttctctttcatgggttctactaatgtctacggtataccggaacatgcgacgtcg
ctaaggctgatggacacttcaggtggaaaggaaccctacaggcttttcaacgttgatgtc
tttgagtacaacatcggtaccagccaaccaatgtacggttcgatcccattcatgttttca
tcttcgtccacatctatcttttgggtcaatgcagctgacacttgggtagacataaagtat
gacaccagtaaaaataaaacgatgactcattggatctccgaaaatggtgtcatagatgta
gtcatgtccctggggccagatattccaactatcattgacaaatttaccgatttgactggt
agaccctttttaccgcccatttcctctatagggtaccatcaatgtagatggaattataat
gatgagatggacgttctcacagtggactctcagatggatgctcatatgattccttacgat
tttatttggttggacttggagtatacgaacgacaaaaaatattttacttggaagcagcac
tcctttcccaatccaaaaaggctgttatccaaattaaaaaagttgggtagaaatcttgtc
gtactaatcgatcctcatttaaagaaagattatgaaatcagtgacagggtaattaatgaa
aatgtagcagtcaaggatcacaatggaaatgactatgtaggtcattgctggccaggtaat
tctatatggattgataccataagcaaatatggccaaaagatttggaagtcctttttcgaa
cggtttatggatctgccggctgatttaactaatttattcatttggaatgatatgaacgag
ccttcgattttcgatggcccagagaccacagctccaaaagatttgattcacgacaattac
attgaggaaagatccgtccataacatatatggtctatcagtgcatgaagctacttacgac
gcaataaaatcgatttattcaccatccgataagcgtcctttccttctaacaagggctttt
tttgccggctctcaacgtactgctgccacatggactggtgacaatgtggccaattgggat
tacttaaagatttccattcctatggttctgtcaaacaacattgctggtatgccatttata
ggagccgacatagctggctttgctgaggatcctacacctgaattgattgcacgttggtac
caagcgggcttatggtacccattttttagagcacacgcccatatagacaccaagagaaga
gaaccatacttattcaatgaacctttgaagtcgatagtacgtgatattatccaattgaga
tatttcctgctacctaccttatacaccatgtttcataaatcaagtgtcactggatttccg
ataatgaatccaatgtttattgaacaccctgaatttgctgaattgtatcatatcgataac
caattttactggagtaattcaggtctattagtcaaacctgtcacggagcctggtcaatca
gaaacggaaatggttttcccacccggtatattctatgaattcgcatctttacactctttt
ataaacaatggtactgatttgatagaaaagaatatttctgcaccattggataaaattcca
ttatttattgaaggcggtcacattatcactatgaaagataagtatagaagatcttcaatg
ttaatgaaaaacgatccatatgtaatagttatagcccctgataccgagggacgagccgtt
ggagatctttatgttgatgatggagaaacttttggctaccaaagaggtgagtacgtagaa
actcagttcattttcgaaaacaataccttaaaaaatgttcgaagtcatattcccgagaat
ttgacaggcattcaccacaatactttgaggaataccaatattgaaaaaatcattatcgca
aagaataatttacaacacaacataacgttgaaagacagtattaaagtcaaaaaaaatggc
gaagaaagttcattgccgactagatcgtcatatgagaatgataataagatcaccattctt
aacctatcgcttgacataactgaagattgggaagttattttttga

DBGET integrated database retrieval system