KEGG   Saccharomyces cerevisiae (budding yeast): YBR230CHelp
Entry
YBR230C           CDS       T00005                                 

Gene name
OM14
Definition
(RefSeq) Om14p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5353
Motif
Other DBs
NCBI-GeneID: 852531
NCBI-ProteinID: NP_009789
SGD: S000000434
UniProt: P38325
Position
II:complement(join(679549..679942,680040..680050))
Genome map
AA seq 134 aa AA seqDB search
MSATAKHDSNASPNSDSEDGHHHNNKKECAIEYLKARLNSASAVACGYLQAFVSKTQDFA
KVCFLELQNPVVLVNLLLHSSVVCYLCNGYANHNARFLKGKPNSTVLATTAGALGLLTLD
GIISKKYYSRYDKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaactgctaaacacgacagtaacgctagcccaaattctgactctgaagacggt
caccaccacaacaataagaaggaatgcgctatcgaatatctgaaggcacggttaaatagt
gcatcagcagtcgcttgcggctacctccaagcttttgtcagtaagacgcaagactttgcc
aaagtatgctttttagaacttcagaatcccgttgtcttggtcaacttgttgctgcattct
tcagtggtatgttatttatgtaacgggtatgcgaaccacaacgccagattcttgaagggg
aaacctaactctacagtcttagcaacaaccgccggcgctctgggtcttttgacgctggac
ggtataatttcaaagaaatactactccagatacgacaagaaataa

DBGET integrated database retrieval system