KEGG   Saccharomyces cerevisiae (budding yeast): YBR241C
Entry
YBR241C           CDS       T00005                                 

Definition
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF624
Other DBs
NCBI-GeneID: 852543
NCBI-ProteinID: NP_009800
SGD: S000000445
UniProt: P38142
Position
II:complement(702589..704055)
AA seq 488 aa
MAETERLMPNGGSRETKPLITGHLILGTIVACLGSIQYGYHIAELNAPQEFLSCSRFEAP
DENISYDDTWVGQHGLKQCIALTDSQYGAITSIFSIGGLFGSYYAGNWANRYGRKYVSMG
ASAMCMVSSLLLFFSNSYLQLLFGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQ
VSINLGILLTQTLALKYADSYNWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEA
ETALFKLRPGTYQQAKQEIQDWQRSHGHNRDPESSEETHSGPTLWQYVTDPSYKKPRTVI
LAILSCQQFCGINSIIFYGVKVIGKILPDYSIQVNFAISILNVVVTLAASAIIDHVGRRP
LLLASTTVMTAMSLLISVGLTLSVSFLLVTATFVYIAAFAIGLGPIPFLIIGELSYPQDA
ATAQSFGTVCNWLATFIVGYLFPIGHGLMGGYVFAIFAAIAAMFATYVYKRVPETKGKTT
YSEVWAGY
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggctgaaactgaaagactaatgcctaacggtggttcccgcgaaacaaaaccgttaatt
acgggccatttaatcttgggcacgatagttgcttgtttggggtcgatccagtacggatac
cacatcgcagagttgaatgcgcctcaagaattcttatcgtgctccagatttgaggcacca
gacgaaaacatctcatacgatgacacttgggttgggcaacacggactcaagcaatgcatt
gcgttaaccgattctcaatacggcgcaattacgtctatattcagcataggcggactgttt
gggtcgtactacgccggtaactgggccaaccgatacggaagaaagtacgtgagcatgggc
gcctcggccatgtgcatggtttcttctctgctgcttttcttttccaactcctacttgcag
ttgctatttggcaggttcctggtaggcatgtcctgcggcaccgccattgtgatcacaccc
ttatttatcaacgagattgcccccgtggagtggagaggcgctatgggatctatgaatcag
gtttctatcaatctaggtatcctgctgacccaaaccttggcactcaagtacgcagactcc
tataactggaggtggcttctcttttccggatccgtgattgcggtagcgaatattttagct
tggctcaaagtggacgaatctccaaggtggctggtgagccacggattcgtctcggaagct
gaaactgctctgttcaagttgcgtccaggaacgtaccaacaagcgaagcaagaaattcag
gattggcagcgtagccatgggcacaaccgcgacccggagtcaagcgaagagactcattca
ggacccacactatggcaatatgttaccgatccctcatacaagaaaccgcgcacagttata
ctcgccatcttgtcgtgccagcaattttgcggcatcaactctattatcttctacggtgta
aaagtgatcggcaagattctaccggactactcgattcaggtaaattttgccatttccatc
ctcaatgtcgttgtcactctagcagcatctgcgatcatcgaccacgtcgggcgccgtcca
ttattgcttgcctcgactacggtgatgaccgccatgtcgctgctgatcagtgtaggtctc
accttgagcgtatcctttttactggtcacggccacttttgtctatattgccgcattcgcc
atcggtctgggacccatccccttcttgatcattggtgagctatcctacccgcaggatgcc
gctacagctcaaagttttggtactgtgtgcaactggcttgccaccttcatcgtcggatac
ctcttcccgataggccacggcctcatgggcggctacgtatttgcgatcttcgccgccatc
gctgccatgtttgctacatatgtgtacaagcgtgtacccgagacaaagggcaagactaca
tacagcgaggtttgggctggctactga

DBGET integrated database retrieval system