KEGG   Saccharomyces cerevisiae (budding yeast): YBR244WHelp
Entry
YBR244W           CDS       T00005                                 

Gene name
GPX2, AMI1
Definition
(RefSeq) glutathione peroxidase GPX2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00480  Glutathione metabolism
sce00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YBR244W (GPX2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YBR244W (GPX2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YBR244W (GPX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 852546
NCBI-ProteinID: NP_009803
SGD: S000000448
UniProt: P38143
Position
II:707528..708016
Genome map
AA seq 162 aa AA seqDB search
MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVI
LGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLG
FKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatctttttatgatttagaatgcaaggacaagaaaggcgaatcttttaagttt
gaccaactgaaaggcaaagtagttctcatagttaatgttgcctccaagtgcggcttcacg
ccgcagtataaagaattggaagaactatacaaaaaatatcaagataaggggtttgttatt
ttggggttcccatgtaatcagttcgggaagcaggaaccgggctctgatgaacaaattacg
gaattttgccagttgaattatggcgttacattcccaattatgaagaagattgatgttaac
ggaagtaatgctgactctgtctataattatttgaaaagccaaaaagcaggtttactaggt
ttcaagggtatcaaatggaattttgaaaagttcttagttgattccaatggtaaggttgtc
caaagattttcctccttaacaaaaccatcgtccttggaccaagaaatccaaagcctgtta
agtaaatga

DBGET integrated database retrieval system