KEGG   Saccharomyces cerevisiae (budding yeast): YBR260CHelp
Entry
YBR260C           CDS       T00005                                 

Gene name
RGD1
Definition
(RefSeq) Rgd1p
  KO
K20643  Rho GTPase-activating protein RGD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YBR260C (RGD1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    YBR260C (RGD1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    YBR260C (RGD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RhoGAP FCH PIN_2 Sec34
Motif
Other DBs
NCBI-GeneID: 852563
NCBI-ProteinID: NP_009819
SGD: S000000464
UniProt: P38339
Structure
PDB: 

Position
II:complement(732639..734639)
Genome map
AA seq 666 aa AA seqDB search
MEETAKKPASATVSAKSSHDGGTDDLAHLFSTPEIKKVLNSDVAINALLSRLKQSLLTCE
EFMKFIRKKYAFEEEHVQELSKQYKHFFNIQGSTNSSLKKMIHEVLGFDGKMAQVKQSYI
TALQKMYSEISSLLLTMTKLRKSVKENSKRLEKDVSDAIHSAEKAQSRYNSLCQDWDKLR
MTDPTKTKLTLRGSKTTKEQEEELLRKIDNADLEYKQKVDHSNSLRNTFITKERPRIVQE
LKDLILEIDTAMTIQLQKYTIWTENLVLNTGVTISPLDSTKSMKSFAGSVSNERDLYSFL
NKYNQTGKHSLLINKNLIPVSYKKHPSMNHGQKNKSPPKFAVDPSRNSIPKRMISTHNES
PFLSSSSNTAAVPNANLNSATPSLNTNKQLPPTMASSISSTSNAAGAMSPSSSIVTSDTT
SSITKTLDPGNNSPQIPEELINSLDSDRPISHIQTNNNMPPGVQKNFKTFGVPLESLIEF
EQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHS
DSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYW
TLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTIAPANPDDANDVNFQIMAMEVLLEVSD
QAFEPE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggaagagactgcgaagaaaccagctagtgccacagtaagtgcgaagtcgtcgcacgat
ggtggcaccgacgatttggcgcacctttttagcacgccagagatcaagaaggtgctaaat
tccgatgtggcaattaacgctttgttgagccgtttaaagcagtcgttgttgacttgtgaa
gagtttatgaaatttattagaaagaaatacgccttcgaagaagagcacgttcaggagctc
tccaagcaatataagcactttttcaacattcagggttccacaaattcatccttaaaaaag
atgattcacgaagttttgggattcgatggcaagatggctcaagtaaagcagagttatatc
accgccttgcagaaaatgtactccgagattagtagtcttttattaacaatgacaaaatta
agaaagtctgtcaaggagaacagcaaaaggctggaaaaggatgtttctgatgccatacac
agcgcagaaaaggcgcaatctcgttacaattcgttgtgccaagattgggacaaattgagg
atgactgacccaacaaaaacaaagctgaccttgagaggttccaaaactacgaaggaacaa
gaagaagaattgttaagaaaaatcgataacgccgatctggaatataagcaaaaagtagat
cattctaattctttgagaaacacattcataacgaaggagagacctagaattgttcaagaa
ttaaaagatttgattttagaaatagacacagcgatgactatccaattgcagaagtacacg
atatggacggaaaatttggttctgaatacaggtgttacaataagcccattggactccacc
aaatctatgaaatcatttgctggatctgtttccaatgaacgtgatctttacagttttttg
aacaagtataaccaaacaggaaaacattccctactgatcaacaaaaacttgatccctgta
tcatacaaaaagcatccatcaatgaatcatggtcagaaaaataagagccccccaaagttt
gccgtggacccttcaagaaactccatcccgaagagaatgatatccactcataatgaatct
ccatttttgagcagtagtagtaacactgccgctgttccgaatgctaatcttaacagtgct
acaccgtccttaaataccaacaagcagttaccacctactatggcttcatctatttcttcc
actagcaatgcggctggcgctatgtcaccgtcttcttccattgtaacaagcgacaccaca
tcatccataacaaagaccctggatcctggcaacaatagtccacaaattccagaagaattg
attaactctttagactcggatcgcccgatttctcacattcagactaacaacaatatgcca
cccggtgttcaaaaaaatttcaaaacatttggtgtaccgctagaatcactgatagaattc
gaacaagacatggtccctgcgatagtgcgccaatgcatatacgttattgataaatttggg
cttgatcaagaaggaatttatagaaaatcggcaaatgtacttgatgtcagcaagttgaag
gaggaaattgataaggatcccgcaaacatttccatgattctaccatcaaagccacattct
gattcggatatttatttagtaggatcactgctgaaaactttttttgcgtcgctgcctgat
agtgttttaccaaaggccctatcatcggagatcaaggtttgtttacaaattgaagaccca
acaacaagaaaaaattttatgcacggactaatatataacctccccgacgcacaatactgg
acgttaagggctcttgtctttcatttgaaaagagtgttggcacatgaagcccaaaacaga
atgaatttaagggctctttgtataatttggggtccaactattgcgcctgcaaatccagat
gacgctaatgatgtaaattttcaaattatggcaatggaagtattattagaggtttcagat
caagcttttgagcctgaataa

DBGET integrated database retrieval system