KEGG   Saccharomyces cerevisiae (budding yeast): YBR291C
Entry
YBR291C           CDS       T00005                                 

Gene name
CTP1
Definition
(RefSeq) Ctp1p
  KO
K15100  solute carrier family 25 (mitochondrial citrate transporter), member 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YBR291C (CTP1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YBR291C (CTP1)
SSDB
Motif
Pfam: Mito_carr YtxH
Other DBs
NCBI-GeneID: 852594
NCBI-ProteinID: NP_009850
SGD: S000000495
UniProt: P38152
Position
II:complement(783673..784572)
AA seq 299 aa
MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKT
AKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGL
LESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSM
RQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKT
RMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVMLA
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtccagtaaagctaccaaaagtgacgtagatccattgcactcgtttctggcagggtcc
ctagccggtgctgctgaagcatgtataacatatccttttgagtttgccaaaacaaggctg
cagctgattgataaggcctccaaggcatcaagaaatcctctggtattgatatataaaact
gcaaaaactcagggcattggttccatttatgtcggatgtcccgcatttattattggaaac
accgctaaggcgggtattagatttcttggctttgataccattaaagacatgctaagagat
agtgaaactggagaactaagtggtacaagaggggtgatagctgggttaggtgcgggacta
ttagaaagtgttgccgcagtgactccttttgaagcaatcaaaactgctttgatcgatgat
aaacaatctgctacaccaaaataccataataatgggcgcggtgtagtacgaaactattca
tcattagtccgtgataaaggattttctggtctttatcgtggtgttttgccagtttccatg
agacaggccgcaaaccaagccgttagattgggttgttacaataagattaagaccttgatc
caagattatacggattcgccaaaagacaaacctttatcatccgggttaaccttcttagtg
ggtgcatttagtggtattgtgacggtctattccaccatgccccttgatactgtgaaaaca
agaatgcaaagtttggattccaccaaatactcctctacaatgaattgttttgcaaccatt
ttcaaagaagaagggttaaagacgttttggaaaggtgctacgcctagacttgggagattg
gtcttgagtggtggtattgttttcactatctatgaaaaggtcttagttatgctagcctga

DBGET integrated database retrieval system