KEGG   Saccharomyces cerevisiae (budding yeast): YBR296C-AHelp
Entry
YBR296C-A         CDS       T00005                                 

Definition
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1466451
NCBI-ProteinID: NP_878055
SGD: S000028605
UniProt: Q8TGU5
Position
II:complement(800123..800242)
Genome map
AA seq 39 aa AA seqDB search
MKVLDDWFSRKFSKAVHGNNHGTISLSTLSYIRVHKLVK
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgctagatgattggttttcaaggaagttctcaaaagctgtacacggaaacaat
cacggcaccatttccttgtcaactctgtcttatatcagagtccataaactagtaaaatga

DBGET integrated database retrieval system