KEGG   Saccharomyces cerevisiae (budding yeast): YBR302CHelp
Entry
YBR302C           CDS       T00005                                 

Gene name
COS2
Definition
(RefSeq) Cos2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUP Myb_DNA-bind_4
Motif
Other DBs
NCBI-GeneID: 852605
NCBI-ProteinID: NP_009861
SGD: S000000506
UniProt: P0CX12 P0CX13
Position
II:complement(810340..811479)
Genome map
AA seq 379 aa AA seqDB search
MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLS
VWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPH
DWEVVAANLNSYLYENNVWNTKYFFFNAMVCQEAFRTTLLEPFSLKKDKAAKVKSFKDSV
PYIEEALGVYFTEVEKQWKLFNTEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLI
PFLNFLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQE
SGANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDCEWFFNHFFYRVLSAKKSMWPLPLNV
ELWPYIKEAQLSRSEVLLV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaatgaacttaaaaatgagaagagtgtagatgtattatccttcaaacagctc
gaatcccaaaagattgttctacctcaagatcttttcagaagcagctttacctggttttgt
tatgaaatttacaagtccttagcgtttcgcatctggatgctattatggctaccacttagc
gtctggtggaaactttccaacaattgtatttacccacttatagtttcacttctggtcctg
tttctgggaccaatatttgtccttgttatttgtggactttctcgtaagcgttccttatcg
aaacaactcattcagttttgcaaagagattactgaaaacacaccaagttctgatcctcat
gattgggaagttgttgcagcaaatctaaattcgtacttatatgaaaataacgtttggaat
actaagtacttttttttcaatgccatggtctgtcaagaagcgttcagaacaacccttctc
gaaccattttctttgaaaaaagataaagctgccaaggttaagtcatttaaggattccgtc
ccttacattgaagaagcattgggagtttattttacagaagttgaaaaacaatggaaattg
tttaatactgaaaaatcatggagccctgttggcctggaagatgctaaacttcccaaggaa
gcttaccgatttaagcttacttggtttttaaagaggatttccaatatttttatgttgata
ccattccttaattttttgtgctgcatatatgtgtcacggggaatgtgccttctattacgc
accttgtatctcgggtggattcttttcatgttggtacaaggtttccaaaatataagggtt
ttgattatgagcatggaacacaagatgcagttcttgtcgactattataaatgagcaagaa
agtggtgcgaatggatgggacgaaattgcaaggaaaatgaataggtacttgtttgagaaa
aaagcctggaagaatgaagagtttttcttcgacgggattgactgtgaatggttttttaac
cacttcttctaccgcgttctatctgcgaagaaatctatgtggcctttaccattgaatgtg
gaactatggccatacattaaagaagcgcaattatcccgcagtgaggtgctcttagtgtag

DBGET integrated database retrieval system