KEGG   Saccharomyces cerevisiae (budding yeast): YCL025CHelp
Entry
YCL025C           CDS       T00005                                 

Gene name
AGP1, YCC5
Definition
(RefSeq) amino acid transporter AGP1
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YCL025C (AGP1)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YCL025C (AGP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 850333
NCBI-ProteinID: NP_009905
SGD: S000000530
UniProt: P25376
Position
III:complement(76018..77919)
Genome map
AA seq 633 aa AA seqDB search
MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFF
DSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTI
QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYS
NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII
FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP
GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL
FLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMA
NSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFT
WLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILIL
IAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR
QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtcgaagtctctatacgaactgaaagacttgaaaaatagctccacagaaata
catgccacggggcaggataatgaaattgaatatttcgaaacaggctccaatgaccgtcca
tcctcacaacctcatttaggttacgaacagcataacacttctgccgtgcgtaggtttttc
gactcctttaaaagagcggatcagggtccacaggatgaagtagaagcaacacaaatgaac
gatcttacgtcggctatctcaccttcttctagacaggctcaagaactagaaaaaaatgaa
agttcggacaacataggcgctaatacaggtcataagtcggactcgctgaagaaaaccatt
cagcctagacatgttctgatgattgcgttgggtacgggtatcggtactgggttattggtc
ggtaacggtaccgcgttggttcatgcgggtccagctggactacttattggttacgctatt
atgggttctatcttgtactgtattattcaagcatgtggtgaaatggcgctagtgtatagt
aacttgactggtggctacaatgcataccccagtttccttgtggatgatggttttgggttt
gcagtcgcttgggtttattgtttgcaatggctgtgtgtgtgtcctctggaattggtgacc
gcatccatgactatcaaatattggacgacatctgtgaacccggatgtgttcgtcattatt
ttctatgttttggtgattactattaatattttcggtgctcgtggttatgcagaagctgag
ttcttcttcaactgttgcaaaattttgatgatgactgggttcttcattcttggtattatc
atcgatgttggtggcgctggtaatgatggttttattggtggtaaatactggcacgatccg
ggcgctttcaatggtaaacatgccattgacagatttaaaggtgttgctgcaacattagtg
actgctgcttttgcctttggtggttcagagtttattgccatcaccactgcagaacaatct
aatccaagaaaggccattccaggtgcggccaaacaaatgatctacagaatcttattccta
ttcttggctaccattattctactgggtttcttggtgccatacaattccgatcaattattg
ggttctaccggtggtggtactaaagcctcgccatatgtcattgctgttgcatcccacggt
gtccgtgtcgtcccacacttcattaacgccgttattctactttccgtgctgtccatggct
aactcctccttctactccagtgctcgtttatttttaactctatccgagcaaggttacgct
cctaaggttttctcctacatcgacagagccggtagaccattgattgccatgggtgtttct
gcattgtttgccgttattgccttctgtgctgcatctcccaaggaagaacaagttttcact
tggttattggccatttctggtttgtctcagcttttcacatggactgccatttgtttatcc
catcttagatttagaagagccatgaaagtccaagggagatctcttggagaattgggtttc
aaatctcaaactggtgtttggggatctgcctacgcttgcattatgatgattttaattctt
attgcccaattttgggtcgctatcgcccccattggtgaaggtaagctggatgcacaagcc
tttttcgaaaactacttggctatgccaatcttgattgcactttatgtcggctacaaggtc
tggcacaaggattggaaactgttcatcagggcagacaagatcgacctagattctcataga
caaatctttgatgaagaattaatcaagcaagaagacgaagaatatagggaacgtttgagg
aacggaccttattggaaaagggtcgttgccttctggtgttaa

DBGET integrated database retrieval system