KEGG   Saccharomyces cerevisiae (budding yeast): YCL032WHelp
Entry
YCL032W           CDS       T00005                                 

Gene name
STE50
Definition
(RefSeq) Ste50p
  KO
K19841  protein STE50
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YCL032W (STE50)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAM_Ste50p RA
Motif
Other DBs
NCBI-GeneID: 850325
NCBI-ProteinID: NP_009898
SGD: S000000537
UniProt: P25344
Structure
PDB: 

Position
III:63441..64481
Genome map
AA seq 346 aa AA seqDB search
MEDGKQAINEGSNDASPDLDVNGTILMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRL
RENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKDDKTQEDMITVLK
NLYTTTSAKLQEFQSQYTRLRMDVLDVMKTSSSSSPINTHGVSTTVPSSNNTIIPSSDGV
SLSQTDYFDTVHNRQSPSRRESPVTVFRQPSLSHSKSLHKDSKNKVPQISTNQSHPSAVS
TANTPGPSPNEALKQLRASKEDSCERILKNAMKRHNLADQDWRQYVLVICYGDQERLLEL
NEKPVIIFKNLKQQGLHPAIMLRRRGDFEEVAMMNGSDNVTPGGRL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggtaaacaggccatcaatgagggatcaaacgatgcttcgccggatctggac
gtgaatggcacaatattgatgaataatgaagacttttcccagtggtcggttgatgatgtg
ataacttggtgtatatccacgctggaggtggaagaaaccgatccattatgtcagagactg
cgagaaaatgatattgtaggagatcttttgccggaattgtgcttgcaagattgccaggac
ttgtgtgacggtgatttgaataaggccataaaattcaagatactgatcaataagatgaga
gacagcaagttggagtggaaggacgacaagactcaagaggacatgataacggtactgaaa
aacttgtacactactacatctgcgaaattgcaagaatttcaatcgcagtacacaaggctg
aggatggatgtcttggacgtaatgaagaccagctcaagctcttctccgattaacacacat
ggagtgtccactacggtaccttcttcaaacaacacaattatacccagtagtgacggtgtg
tctctttcacaaacagactatttcgacacagttcataaccgacaatcaccgtcaaggaga
gaatccccggtaacggtatttaggcaacccagtctttcccactcaaaatctttgcacaag
gatagcaaaaacaaagtaccccaaatatctacaaaccaatctcacccatctgccgtttca
acagcgaacacaccggggccatcacctaacgaggcgttaaaacagttgcgtgcatctaaa
gaagactcctgcgaacggatcttgaaaaacgcaatgaaaagacataacttagcagatcag
gattggagacaatatgtcttggtcatttgctatggggatcaagagaggctgttagaattg
aacgaaaagcctgtgatcatattcaagaacttaaagcaacagggtttgcaccccgccatt
atgttaagaagaagaggtgatttcgaagaagtagcaatgatgaacggaagtgacaatgtc
acccccggtggaagactctaa

DBGET integrated database retrieval system