KEGG   Saccharomyces cerevisiae (budding yeast): YCL033CHelp
Entry
YCL033C           CDS       T00005                                 

Gene name
MXR2
Definition
(RefSeq) Mxr2p
  KO
K07305  peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YCL033C (MXR2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     YCL033C (MXR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SelR Yippee-Mis18 DZR
Motif
Other DBs
NCBI-GeneID: 850324
NCBI-ProteinID: NP_009897
SGD: S000000538
UniProt: P25566
Position
III:complement(62776..63282)
Genome map
AA seq 168 aa AA seqDB search
MNKWSRLYVITVRRTFPGRRNIVLTQYWNKSKKMSDESNDVKWNDALTPLQLMVLRDKAT
ERPNTGAYLHTNESGVYHCANCDRPLYSSKAKFDARCGWPAFYEEVSPGAITYHRDNSLM
PARVEICCARCGGHLGHVFEGEGWKQLLNLPKDTRHCVNSASLNLKKD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtggagcaggctgtacgttataactgtacgcaggacttttccagggagaaga
aacattgtactgacgcagtactggaataagagcaagaaaatgagtgacgaatcgaatgac
gtgaagtggaacgatgccctgacaccattgcagctgatggtgctgagagataaggccact
gaaaggcccaacaccggtgcgtatttacacaccaacgagtccggtgtctaccattgtgcc
aactgcgacagaccgttgtattcgagcaaggccaagttcgacgctcgttgtggatggccc
gcattctacgaagaggtatcccctggagccatcacatatcatcgtgacaattctttaatg
cctgcgagggtggagatatgttgtgcaaggtgtggtggacacttgggacatgtgtttgaa
ggtgaaggctggaaacagttgctaaacttgcccaaggacaccagacactgtgtgaacagt
gcgtctttaaacctcaagaaggattaa

DBGET integrated database retrieval system