KEGG   Saccharomyces cerevisiae (budding yeast): YCL035CHelp
Entry
YCL035C           CDS       T00005                                 

Gene name
GRX1
Definition
(RefSeq) dithiol glutaredoxin GRX1
  KO
K03676  glutaredoxin 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YCL035C (GRX1)
Chaperones and folding catalysts [BR:sce03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YCL035C (GRX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin Thioredoxin_3 GST_N_2 Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 850322
NCBI-ProteinID: NP_009895
SGD: S000000540
UniProt: P25373
Structure
PDB: 

Position
III:complement(60841..61173)
Genome map
AA seq 110 aa AA seqDB search
MVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGA
DIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILAN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggtatctcaagaaactatcaagcacgtcaaggaccttattgcagaaaacgagatcttc
gtcgcatccaaaacgtactgtccatactgccatgcagccctaaacacgctttttgaaaag
ttaaaggttcccaggtccaaagttctggttttgcaattgaatgacatgaaggaaggcgca
gacattcaggctgcgttatatgagattaatggccaaagaaccgtgccaaacatctatatt
aatggtaaacatattggaggcaacgacgacttgcaggaattgagggagactggtgaattg
gaggaattgttagaacctattcttgcaaattaa

DBGET integrated database retrieval system