KEGG   Saccharomyces cerevisiae (budding yeast): YCL037CHelp
Entry
YCL037C           CDS       T00005                                 

Gene name
SRO9
Definition
(RefSeq) Sro9p
  KO
K18757  la-related protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YCL037C (SRO9)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YCL037C (SRO9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: La
Motif
Other DBs
NCBI-GeneID: 850320
NCBI-ProteinID: NP_009893
SGD: S000000542
UniProt: P25567
Position
III:complement(57374..58678)
Genome map
AA seq 434 aa AA seqDB search
MSAETAAANTATAPVPEVQEQESSKSKQVNLTPAPLPTSSPWKLAPTEIPVSTISIEDLD
ATRKKKNRTPTPKSSTATKWVPIKASITVSGTKRSGSKNGASNGNSNKSKNNKTAASSTS
SSNANRKKKHHQHNAKKQQQMKKDGFESAVGEEDSKDATSQENGQSTQQQQPPHHRNHHH
SHHHNSNGPQRRKFHNSNNAGMPQNQGFPPQFKPYQGRNARNNNNNRSKYHNHFHHNQQH
PQQPMVKLQQQFYPVQPVLMAINNIARQIEYYFSEENLTVDNYLRSKLSKDGFAPLSLIS
KFYRVVNMSFGGDTNLILAALREIVANEAATVNVAEGTLAAKEGDNVTGEAKEPSPLDKY
FVRSKSWSNWLPETFETEINIEKELVGDALDQFMISLPPVPQQEEESSTELASQEQETKE
DSAPVAAGESESSL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaaccgccgccgcaaacactgctactgccccagtcccagaagtgcaagaa
caagagagctccaagagcaagcaagtcaacttgacgccggcaccattgcccacatcttcc
ccatggaaacttgctcctactgagatccctgtttctactatctcaatagaagacttggat
gccacaagaaagaagaagaacagaacacccactccgaaatcatcgactgctaccaagtgg
gttcccatcaaggcctccattaccgtctctggcaccaaaagatccggttccaagaatggt
gcaagtaatggcaacagcaacaagagcaaaaacaacaaaactgcagcatcgtcgacatcg
tcgagtaatgctaacaggaaaaagaagcatcaccaacataatgctaagaagcaacaacaa
atgaagaaagatggctttgaatcggcagtaggtgaggaagattcaaaagacgctacctct
caagaaaatggtcaatctacacaacagcaacaaccacctcaccaccgtaatcatcaccac
agtcatcaccataacagcaatggtcctcaaaggagaaagttccacaacagtaataacgcc
ggtatgcctcagaaccaaggcttcccaccacagtttaaaccttaccaaggacgcaacgct
cgtaataacaacaacaaccgctctaaataccacaaccacttccatcacaaccaacaacat
cctcaacaacctatggtcaaattacagcaacagttttatccagtccaaccagtgttaatg
gccatcaacaacattgctagacaaattgaatactatttcagcgaagaaaacttgaccgtc
gacaattacttaaggtccaaactctccaaggatggttttgctccattgtctttaatctct
aagttttacagagttgttaacatgtccttcggaggtgacactaacctgattttagccgca
ttgagagaaattgtcgctaacgaagccgctaccgtcaatgttgcagaaggtactttggcc
gccaaggaaggtgataacgttaccggtgaagccaaagaaccatctccattggataagtac
ttcgttcgttccaagagctggtcaaactggttaccagaaacttttgaaactgaaattaat
attgaaaaagaactggtcggcgatgcattggaccaattcatgatatccctaccacctgtt
cctcaacaagaagaggaatcatccactgaactcgcttctcaagaacaagaaaccaaagaa
gactctgcgccggttgctgccggtgaatccgagtcttccttataa

DBGET integrated database retrieval system