KEGG   Saccharomyces cerevisiae (budding yeast): YCL038C
Entry
YCL038C           CDS       T00005                                 

Symbol
ATG22, AUT4
Name
(RefSeq) Atg22p
  KO
K06902  MFS transporter, UMF1 family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YCL038C (ATG22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YCL038C (ATG22)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YCL038C (ATG22)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   Others
    YCL038C (ATG22)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    YCL038C (ATG22)
SSDB
Motif
Pfam: ATG22 MFS_1
Other DBs
NCBI-GeneID: 850319
NCBI-ProteinID: NP_009892
SGD: S000000543
UniProt: P25568
Position
III:complement(54941..56527)
AA seq 528 aa
MSYGTINDMNESVTNYRIKKAQNNIKGWYAYSFSSEPFVVSAVSTYIPLLLQQFASINGV
KVHDHSIPCLSETGSDSDKCVLGLFNNRIFVDTSSFALYVFSLSVLFQTIIVISVSGIVD
LWGSVKFKGRILVWFGIVGALSTVAISKLNDTQIYSLAGLYIVANGCFGVINVVGNSLLP
IFVKDSLKCQSQGAYEPDKVDSLTTVISGRGASLGYSSALIVQIVSMFLVASKKGSKQDV
QVAVLFVGIWWFVWQLPMIWLIDDVTIPIRVDDSTLASARSPYPGEQDALGQLNWKNYLS
YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSKAELHMSTLNLIMISV
LTVVNAMLGAFMIPQFLATKFRWTSSQTLMYIIIWASFIPFYGILGFFFNAFGLKHKFEM
FLLAIWYGLSLGGLSAVSRSVFSLIVPPGKESTFFSMFSITDKGSSILGPFLVGLLTDKT
HNIRYSFYFFFLLLMLSLPVLNCLDVKRGRREAEELSQVLPESERRLD
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgagctatggaactataaatgatatgaatgaatcggtaacgaactatcgaataaaaaaa
gcccaaaacaatatcaagggatggtacgcttactcattttctagcgaaccatttgtcgtt
tctgcggtttcaacgtatattcccttactactgcagcaatttgcgagtataaatggtgta
aaagttcacgatcactccataccctgcctgtcagaaacgggtagtgattcagataagtgt
gttcttggtttgttcaacaatcggatcttcgtagatacttcaagttttgcattatatgtc
ttttcccttagcgttttattccaaactataatagtcatttccgtttcagggatagtagat
ctctgggggagcgttaaattcaaaggcagaattctggtttggtttggtattgtgggcgca
ttgtcgactgttgcgatttcaaaattgaatgatacccagatttattctctggctgggctt
tatatagtggccaatggttgttttggcgttatcaatgttgttgggaattctcttctgccc
atttttgtcaaggattctttgaaatgtcaaagtcaaggagcttatgaacctgataaggta
gactcgttaactactgttattagcggtagaggtgcatctttaggttattcaagtgccctc
attgttcagattgtatctatgttcttagtcgcatctaaaaagggcagtaagcaggatgtt
caagtggctgttcttttcgttgggatttggtggtttgtgtggcaactgcccatgatctgg
ttgattgacgatgtgacaataccgataagagttgacgattctacattagcatccgcccgc
agtccgtatcccggtgagcaagacgccttgggtcaactaaactggaagaattacctttca
tatggttgggtttcgcttttcgaatcgtttaaacatgccagactattgaaagatgtgatg
atttttcttattgcgtggtttattattagtgattccattacaactataaattctacagcg
gttttgttctccaaggcagaactgcacatgagtaccctcaatttaatcatgataagtgtt
ttgaccgttgtaaatgcaatgctgggtgcctttatgattccacaatttcttgccacaaag
tttcggtggacttctagtcaaactttgatgtacattatcatttgggcaagtttcatacca
ttttatggtattcttggatttttcttcaatgcgttcggtttaaagcataagtttgaaatg
ttcttattggccatttggtatggattatcactaggtggcctgtccgcggtttcaagatca
gttttcagtttgattgtacctccaggaaaagaatccacgttttttagtatgttcagtatc
acagataaggggtcgtccatcctgggacccttccttgttggactgcttaccgataaaacg
cataatattcgctattcgttttatttcttctttttgcttttgatgctatcattgcctgtg
ctaaactgtttggatgtcaagagaggtagaagagaggctgaagaactcagtcaagtttta
cctgaaagtgaaagaaggttggattag

DBGET integrated database retrieval system