KEGG   Saccharomyces cerevisiae (budding yeast): YCL039WHelp
Entry
YCL039W           CDS       T00005                                 

Gene name
GID7, MOH2
Definition
(RefSeq) glucose-induced degradation complex subunit GID7
  KO
K22382  WD repeat-containing protein 26
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YCL039W (GID7)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     YCL039W (GID7)
   CTLH complex
    YCL039W (GID7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 DUF4221
Motif
Other DBs
NCBI-GeneID: 850318
NCBI-ProteinID: NP_009891
SGD: S000000544
UniProt: P25569
Position
III:52645..54882
Genome map
AA seq 745 aa AA seqDB search
MSHTNKIAYVLNNDTEETASPSSVGCFDKKQLTKLLIHTLKELGYDSAANQLLLESGGYQ
NESNHIQTFFKLIKTGQFHLINWQIVCSLPLAHSSPLRSEWLQRLLIPTPTPATTSLFDH
MLLQLQYLQQLMSSVNSSTCSDAEIATLRNYVEIMILVNRQIFLEFFHPVTNSASHKGPH
TALPVLYLRKILKNFIEIWDSLLVSNDQFLNEENIFNPETTLRELSTYLTNPKLTAQLNL
ERDHLIDAISKYIDPNELVPKGRLLHLLKQAIKYQQSQDIFNIIDPDDDASFSSPPHRIN
LLQDNFSHDLTVTFQEWKTIQDTTDEIWFLTFSPNGKYLASATSESSRGYFITVYDVEQD
FKIYKTCVSLSQSVLYLMFSPDSRYLVACPFSEDVTIYDMNATSLPDASATDSFLLYPST
RLSPMDSFKLDTTTYPDDTESSASSSSRPANANSNQSRVWCCDAFHTAERAGWMVVGSPD
REAIVHSLTTKESLFSLKGRTCIALGHDENISGRKSIDPAKVLYKPTSSNGNWQYVEDDE
TFPRVHDVKISYDDKYVLLMTHQGVIDVYDFSGFPSKEELSKQTVDPKNFLIPRIARLDV
GKNMTCISLPLNTTHQGFHRQQISESQHLVLVSLQDNELQMWDYKENILIQKYFGQKQQH
FIIRSCFAYGNKLVMSGSEDGKIYIWDRIRGNLVSVLSGHSTVMSNSTKPMGKNCNVVAS
NPADKEMFASGGDDGKIKIWKISRN
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacactaataagatcgcatacgtgttgaacaatgacacggaggaaacagcctcg
ccctcttccgttggttgttttgacaagaaacagctcactaaattactgatacatactcta
aaggagctgggctacgactccgccgctaaccagttactgctagagagcggcggatatcaa
aatgagtctaaccacatccagactttcttcaaactcatcaagaccggccaattccatctt
attaattggcagattgtttgctcgctgccccttgcccatagctctccgctaaggtccgaa
tggcttcaaaggctgctcattcccacgccgacgcccgccacgacttcacttttcgaccac
atgctcctgcaactgcaatacctgcaacagctgatgagctctgtaaattcatctacttgt
tcggacgcagagatcgccacgctcagaaattacgtagagatcatgattctagttaataga
caaatattcctcgaattcttccatccagtcacaaattccgcctctcacaagggccctcac
actgcactgcccgtcctgtatttgcgcaaaatcctcaaaaacttcatcgagatatgggat
tccctgctggtgtctaacgatcagttcctaaatgaagaaaacatcttcaatccggaaacg
accttgagagaactgtcgacgtacctgaccaacccaaaactaaccgcgcagttgaacctc
gagcgagaccatctgattgacgccatctccaaatatatcgatccgaacgaactcgttccc
aagggtcgtctcttgcatctcttgaaacaggccatcaagtatcaacaatcacaagacatt
tttaatatcatcgatccggatgatgacgcctctttctcctctccaccccaccggatcaac
cttttgcaggataacttctcacacgatctgactgtgacctttcaagaatggaagactatc
caagacaccacagacgaaatttggtttttgacattttcgcccaatggcaagtatttggct
tctgcgacttccgagtcttcaagaggctacttcattactgtttatgatgtggaacaagac
ttcaaaatttataagacttgcgtgagcttgtcacaatccgtattgtacctcatgttttct
cctgatagccggtatctggttgcttgccctttcagcgaagatgttaccatttacgacatg
aatgccacctccctgcccgatgcgtctgccacagactcgttcctactatacccttctacc
aggctctcgcccatggactcgtttaaactggacaccaccacgtacccagatgataccgaa
tcatcagcatcatcttcctcgaggccggcaaacgcgaattctaatcaatcaagagtatgg
tgctgcgatgccttccacactgcggaacgtgcgggctggatggtggttggatcgcccgac
agagaagctattgtacactcactcaccacgaaagagtcactttttagcttaaaaggcagg
acttgtatcgcgttgggccacgatgaaaacatctctgggagaaaatcaatcgatcctgca
aaagtcctttacaaaccaacaagtagcaatggtaactggcaatatgtggaggacgacgaa
acctttccacgtgtgcacgacgtgaaaatcagctatgacgataaatacgtgcttttaatg
acccaccagggcgttatagatgtctacgatttcagtgggttcccctccaaagaggagcta
tctaagcaaacagtggatcccaaaaactttctgattccaaggatcgcaagattggacgtg
ggcaaaaacatgacttgtatctcattaccgctaaataccacgcatcaaggcttccatagg
caacaaatatccgagtctcaacatttggtattagttagccttcaagataacgaattacaa
atgtgggactataaagaaaatattctcatacaaaagtactttggacagaagcaacagcac
tttattatcagatcttgcttcgcctacggtaataagcttgtcatgagcggatcagaagat
ggtaaaatttacatttgggatagaattagaggtaacctagtatctgttttatccggtcat
tccacggtaatgagtaattccacaaaacccatggggaaaaattgtaacgtagttgcatca
aaccctgcagataaagaaatgtttgcttctggcggtgatgacggtaagataaaaatctgg
aaaatttcaagaaattaa

DBGET integrated database retrieval system